KEGG   Geobacillus thermoglucosidasius: Geoth_2243Help
Entry
Geoth_2243        CDS       T01531                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Geoth_2243
   00051 Fructose and mannose metabolism
    Geoth_2243
Enzymes [BR:gth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Geoth_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2160189..2161514)
Genome map
AA seq 441 aa AA seqDB search
MAYFPNIETIVYEGPTSKNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG
AGNMIRPWNKYSGMDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDII
VDMIEEYMKTSKTKLLWNTANLFTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGA
ENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQ
YDFDVATALAFLQTYGLKDYFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDM
LLGWDTDEFPTDLYSTTLAMYEILKNGGLGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDS
FAVGLKVAHRLIEDRVFDEFIEERYKSYTEGIGREIVEGTADFHKLEAHALQLGEIQNQS
GRQERLKTLLNQYLLEVCAAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcttatttcccaaatatcgagacgatcgtgtacgaaggtccaacatcgaaaaacccg
cttgcgtttaagttttacaatccggaagaaaaagtcggcgataaaacaatggaagagcat
ttgcgtttttcggttgcgtattggcatacgtttacaggagatggatcagatccgtttggg
gctggcaatatgatccgtccatggaacaaatacagcggaatggatttggctaaagcgcgt
gttgaagctgcttttgagttttttgaaaaattaaatattccatttttctgtttccatgat
gtggatattgccccagaaggagaaacattaaaagaaacatataaaaatttagatattatc
gtagacatgattgaggaatatatgaaaacaagcaaaacgaagctgctttggaatacggcg
aacttatttacccatcctcgctttgtccatggcgccgccacttcttgcaacgccgatgtt
tttgcctatgcagcggccaaagtaaaaaaagggttggaaattgcgaagcggctaggagcg
gaaaactacgtattttggggcggacgagaaggatatgaaacactattaaataccgatatg
aaacttgagctggacaacttggcccgcttcttgcatatggcggtggattatgcgaaagaa
atcgggtttgacgggcaatttttaattgagccgaagccgaaagagccgacgaaacaccaa
tatgactttgatgttgcgacagcattggcatttttgcaaacatacggactgaaagattac
tttaagttcaatattgaagcgaaccatgcaacgttggcgggacatacgtttgaacatgaa
ttgcgggtagcgcgcattcatggcatgttaggctctgttgacgcaaaccaaggagatatg
ttgttaggatgggatacggacgaattcccgacagacttatattctacgactttggcaatg
tatgaaattttgaaaaacggcggccttggccgtggcggtttgaattttgatgcgaaagta
agaagaggatcgtttgagccggaagatttgttctatgcccatatcgccggaatggacagt
tttgcggttggattaaaagtagcccatcggttaatagaagaccgcgtttttgatgagttt
attgaagaacggtacaaaagttatacagaaggaattggccgggaaatcgtcgaaggaacg
gcagatttccacaaattagaagcacatgctttacaactaggggaaatccaaaatcaatcg
ggcagacaagaacggctgaaaacattgcttaaccaatatttgcttgaagtttgcgcagcc
cgttaa

DBGET integrated database retrieval system