KEGG   Geobacillus thermoglucosidasius: Geoth_2250Help
Entry
Geoth_2250        CDS       T01531                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gth  Geobacillus thermoglucosidasius
Brite
Enzymes [BR:gth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Geoth_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2167989..2169227
Genome map
AA seq 412 aa AA seqDB search
MRNVLRKPIVAGLSLTLLLPIGVNDTSAADTASYAKKPNISALHAPQLDQRYKDSFTIGA
AVEPYQLLNEKDVQMLKHHFNSIVAENVMKPAIIHPSENEYNFGPADQIIQFAKENHMNV
RGHTLVWHQQVPDWFFYDKDGKWMPNETDPQKREANKQLLLQRLRDHIKTVVTRYKDVVK
SWDVVNEVIDDGNPNNPWGLRESNWYKVAGIDYIKVAFETARKYAAPNAKLYINDYNTEI
EPKRTRLYNLVKYLKDQDVPIDGIGHQSHIQIGWPSEAEIEKTINMFADLGLDNQITELD
VSMYGWPPRAYPTYDAIPEQKFLDQAARYDRLFKLYEKLGDKISNITFWGIADNHTWLDS
RADVYYDSNGNVVVEPNAPYARVEKGKGKDAPFVFDPDYRVKPAYWAIIDHK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcggaacgttttacgcaaaccgattgttgccggactgtccttaacgttattgttgcct
ataggagtgaatgacacatctgctgcagatacggcttcctatgcgaagaaaccaaacatc
agcgcgttgcatgctccgcagttagaccagcgttacaaagattcgttcaccatcggcgca
gcggtggaaccttatcagttgttgaacgaaaaagatgtgcaaatgttaaaacaccacttt
aacagcattgtagccgagaacgtgatgaaacctgccattatccatccgtcggaaaatgaa
tacaactttggacctgctgatcaaatcatccagttcgctaaagaaaatcatatgaacgtt
cgcggccacacgctcgtttggcaccaacaagtgcctgactggtttttctatgataaggat
gggaagtggatgcctaacgaaacggatccacaaaagcgcgaagctaataaacagctttta
ctgcaacgcctgcgcgatcatatcaaaaccgttgtcacccgctataaagacgttgtaaaa
tcgtgggatgttgtcaatgaggtcattgatgatggcaatcccaacaacccgtggggactg
cgtgaatcgaattggtataaggtcgctggcatcgactatattaaagtcgcttttgaaaca
gcacggaaatatgctgcgcccaacgcgaaactttacattaacgactataatacagaaatc
gaaccaaaaagaactcgactttataacttagttaaatacttgaaagaccaagacgttccg
atcgatggcatcggccatcagtcccacatccaaatcggctggccttctgaagcagaaatc
gagaaaacgattaacatgttcgccgacctagggttggataaccaaatcacggagcttgat
gtgagtatgtatggttggcctccacgcgcctacccgacgtatgacgccattccggaacaa
aagtttttggatcaagccgcgcgttacgaccgtttatttaagttgtacgaaaaactgggc
gataaaatcagcaacatcaccttctggggcattgccgacaatcatacgtggctcgacagc
cgagcagatgtatactatgattccaacggaaacgttgtggtagagccgaatgctccatat
gcaagggtagaaaaaggaaaaggaaaagacgcaccgtttgtgtttgacccggattaccgt
gtaaaacctgcctattgggccattatcgatcataaataa

DBGET integrated database retrieval system