KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2267Help
Entry
Geoth_2267        CDS       T01531                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00052  Galactose metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
Module
gth_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_2267
   00052 Galactose metabolism
    Geoth_2267
Enzymes [BR:gth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Geoth_2267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEH48195
Position
complement(2189361..2190410)
Genome map
AA seq 349 aa AA seqDB search
MEISIKTWSQLNGKDVLLFTLTNDHGVELLVTNYGCIVTKLLVPDRKGNMENVVLGFGQF
EPYLENSPYFGAVIGRVAGRIQGASFELGGVTYSLAKNENNNHLHGGPNGFHRVLWQAMP
VRRDDAVGVVFSYTSPDGEEGYPGTVHVQVTYWLNNDNEWTVTYRARSNKTTLLNLTNHT
YFNLSGNGKRDILDHTLTIRSSRVLELNEELIPTGHVLDVANTPFDLRQGKKIREAVESE
HPQIELVGGGYDHPFWLDRHHDKEIVLSDPESGRVLTVETDEVGVVVYTSNQLPDGLDLG
GTPSRKYLGICLETQGLPDAIHHPQFPSIVLPAGKEWVSTTVYRFGVIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttggagatttccataaagacgtggtcccaactcaacggaaaagacgttcttttgtttacg
ttaacgaacgatcacggcgtggaactattggtgaccaattacggctgcatcgtaacgaaa
ctgctcgttccggatcgaaagggaaacatggagaacgttgtgcttgggtttggccagttt
gagccgtatttggagaactccccttactttggggcggtgatcggccgggtggcggggcgc
attcaaggggcaagtttcgagctcggtggcgtcacgtattcgttggcgaaaaacgaaaac
aacaaccacttgcatggcgggccgaacggcttccaccgcgtgctttggcaggcgatgccc
gttcggcgcgatgatgcggtcggggtcgtcttttcttacacgagcccggatggggaagaa
gggtatcccggaacggttcatgttcaagtgacatattggctgaacaatgacaacgaatgg
accgttacgtaccgggcccgttcgaacaaaacgacattgctcaatttaacgaaccatacg
tattttaacttaagcggcaacggcaaacgcgatattttggaccatacgttgacgatccga
agctcgcgtgtgctagagctgaatgaggagttgattccgacgggacatgtcctcgatgtc
gccaacaccccatttgatttgcggcaaggaaagaaaatacgggaggcagtcgaatccgaa
catccgcaaatcgaactggtcggcggggggtacgaccatccgttttggcttgatcggcat
catgacaaggaaatagtgctttctgatccggagagtgggcgagtgttgacggttgagacg
gatgaagtcggggtggtcgtgtacacatcgaaccaattgccggacggacttgaccttggc
gggacaccgtcgcggaaatatctcggcatttgccttgaaacgcaagggttgccggatgcg
attcatcatccgcagtttccgtcgatcgtattgccggccgggaaggagtgggtgtcaacg
acggtctatcggtttggcgtaattgaataa

DBGET integrated database retrieval system