KEGG   Geobacillus thermoglucosidasius: Geoth_2294Help
Entry
Geoth_2294        CDS       T01531                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gth00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2219961..2220932
Genome map
AA seq 323 aa AA seqDB search
MYKPKDSSQSPRFCGVRTFMRLENMKTTDNVDFVVLGVPFDTAASNRTGQRYGPQHIRNF
SVLLRPYNPDMDINIFEYCSGVDYGDIDVIPGNALRTYDHIVKELRPVLQKNIIPIIMGG
DHSITLGNLRAFHERFGPVALVHFDSHGDTWDHYYGEKYMHGTPFRRAVEEGLLDVDHSI
QIGMRGPLYSADDIEDARRLGFEVITMKEVRQIGFSEVMKRIHNRVGDKPVFVSYDIDFV
DPAFAPGTGTPEVGGPTSYEALEYVRGLDGLNIVGFDLVEVLPSYDSGEITAVLASAIIY
EMITLVALKKRRALQKNLSATTQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgtataaaccaaaagattcatcccaatctccccgcttttgcggagtccggacatttatg
cgcttagaaaatatgaaaacaacggacaatgttgattttgtcgtactcggtgtgccgttt
gatactgccgcttctaaccgaaccgggcaacggtatggaccgcagcacattcgaaatttt
tctgtattgcttcgcccttacaatccagatatggacattaatatctttgaatattgttct
ggagtagattatggagatattgacgtcattccaggaaacgcgctgcgaacatacgatcat
attgttaaagagttgcggccagtgttacagaaaaatatcatcccgattattatgggcggc
gatcattcgattacattaggaaatttgcgggcatttcatgagcgctttgggccagtggcg
cttgttcatttcgactctcacggagatacttgggatcattattatggtgaaaaatatatg
catggcacgccattccgccgtgctgtcgaagaagggctgctggacgtggatcattccatt
caaatcggcatgcgcggaccgctttatagtgcggatgatatagaagatgcgcgacggctt
ggttttgaagtcattaccatgaaggaagttcggcaaattggattttctgaagtaatgaaa
cgcattcacaaccgtgtgggggataaacctgttttcgtttcctatgatatcgactttgtc
gatcctgcgtttgctcccggcaccggcacaccggaagtaggagggccaaccagctacgaa
gcactagagtatgtaaggggactcgatgggctaaatattgtcggatttgacctcgttgaa
gtattgccttcttatgacagcggggaaattacagctgtgttagcatctgccattatctat
gagatgatcacactggttgcattaaagaaaagacgagccttgcaaaaaaatttatctgca
acaacacaatga

DBGET integrated database retrieval system