KEGG   Geobacillus thermoglucosidasius: Geoth_2316Help
Entry
Geoth_2316        CDS       T01531                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Geoth_2316
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Geoth_2316
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Geoth_2316
Enzymes [BR:gth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Geoth_2316
Exosome [BR:gth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geoth_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2241664..2243310
Genome map
AA seq 548 aa AA seqDB search
MKNIGRKIISFALIGSLTAGSFAFAAREEAKEKQKSKPIKNVIMMVMDGTSAGATTLARW
YKGAPLALDEMASGAVRTYSAESAITDSAPAATAMATGFKSNDKYIGILPSVVNSPGVSP
ISKEHAMKPVANVLEGAELMGKATGIIATSAIQHATPAGFSAHVKHRNLFPDIAEQQVYQ
DIEVVLGGGKEALLPGSGTNNRKDNENMLEVIKKKGYDVVETRDDLLRSTSNKIWGVFAD
DALAQDMNRPYTRPNEPTLAEMTKKAIETLSKDKDGFFLFVEGSQPDWAAHANDPVGIIS
EVLAFDKAVAEALSFAKKRNDTLVIAVSDHGNSGITIGNRNTDQSYPETPVSAYVDPLKK
ARMTLEGAMSQLKADKSNLEEVARLYGLDSLTADEKKKLNESNNLRKTLTELLAARANLG
FTTGGHTGEDVFLYTYGPNRPIGTFENTDLAHIMAKAMGFQLSDLNKRLFVNAKENFAAI
GATVTIDDTDAQNPKLIVKKGKTVAEFPANKNIMIAGNKTYELEGLVVNSAEQFWVPKQA
VKLFKQIQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatattggccgaaaaattatcagttttgcattaatcggctctctcaccgctgga
tcttttgctttcgcggcacgcgaagaagcaaaggaaaagcaaaaatccaaaccaatcaaa
aacgtcatcatgatggtaatggatggaacaagcgcgggagcgacgacattggcaagatgg
tataaaggagcgccgctcgctttagatgaaatggcaagcggcgctgtccggacgtactct
gccgaatcagcaatcacagactctgccccggccgccaccgcgatggcaacaggatttaaa
tccaacgacaagtatatcggcattctcccaagtgttgtgaattctccgggcgtatccccc
atttcgaaggaacacgcgatgaaaccggtcgcaaatgtgctcgaaggcgccgaattgatg
ggaaaagcaacgggaattatcgcaacatcggctattcagcatgccacgccggcaggcttc
tccgcccatgtcaagcaccgcaacttgtttcctgatatcgctgaacaacaagtgtatcaa
gatatcgaagtcgtcttaggcggcggaaaagaagcgctacttccaggcagcggaacaaac
aaccgaaaagataacgaaaatatgcttgaagtcattaagaaaaaaggatacgatgtcgtg
gaaacgcgagacgatctgcttcgttccacatctaataaaatttggggcgtgtttgccgat
gacgcacttgcccaagacatgaaccgcccgtatacaagacctaatgaaccaacgctggcg
gaaatgacaaaaaaagcgatcgaaacactttcaaaagataaagacggatttttcttattt
gtggaaggcagccagccggattgggcagcccatgccaatgatcctgtcgggattatcagt
gaagtgctggcctttgacaaagcggtggcagaagcgctttcctttgcgaaaaaacgcaac
gacacgctcgtcattgccgtatccgaccatggcaacagcggcattacgatcggcaaccgc
aacaccgatcagtcgtaccctgaaacccctgtttccgcatatgttgatccgctgaaaaaa
gcaagaatgacgctagaaggggctatgagccaattaaaagcggataaatccaatttagaa
gaagtggcccgtttatacggattagactcattaaccgccgatgagaagaaaaaattaaac
gaatccaataatctccgcaaaacattgacggaattgctggccgcgcgcgcgaatcttggg
tttaccaccggcggacatacgggggaagatgtctttctctacacttatggcccgaaccgg
ccaatcggcacatttgaaaatacggatttagcccacatcatggcaaaagcgatgggtttt
caattaagcgatttaaataaacggttatttgtcaacgcgaaagaaaactttgcggcgata
ggagcgaccgtaacgatcgatgacacagatgcacaaaatcctaagttgatcgtgaaaaaa
ggaaagacggtggctgagttccctgcgaacaaaaacattatgatcgccggaaacaaaacg
tatgaattagaagggcttgttgttaacagcgcagaacaattttgggttccaaaacaagcg
gttaaactttttaaacaaattcaatag

DBGET integrated database retrieval system