KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2753Help
Entry
Geoth_2753        CDS       T01531                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00230  Purine metabolism
gth01100  Metabolic pathways
Module
gth_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Geoth_2753
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Geoth_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ABC_tran AAA_22 MMR_HSR1 AAA_16 RsgA_GTPase AAA AAA_33 HEM4 CoaE
Motif
Other DBs
NCBI-ProteinID: AEH48641
Position
complement(2683930..2684544)
Genome map
AA seq 204 aa AA seqDB search
MSERGLLIVLSGPSGVGKGTVRKALFSQPDINLHYSVSVTTRKPREGEVDGVDYFFKTRE
EFEQMIRENKLLEWAEYVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAMQVRKVFPEGLF
IFLAPPSLSELEKRIISRGTESAEHIQNRLKAAKEELEMMDAYDYVVENDKVELACERIK
AIVMAEHCRRERVAKRYKRMLGVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagaggattgttgattgtgctgtctggcccgtctggtgtcggcaaaggaacg
gtgcggaaagcattgttttcgcagccggatattaatttgcattattctgtttccgtcacg
acgcggaaaccgcgggaaggcgaagtcgatggcgtcgattatttctttaaaacgcgcgaa
gaatttgagcaaatgattcgcgaaaacaaactgttggagtgggcggagtatgtcggcaat
tactatggaacgccgatcgactatgtggaaaaaacattgcaagaaggaaaagacgtgttt
ttggaaatcgaagtgcaaggcgcgatgcaagtgcgcaaagtgtttccggaaggcctcttc
atttttctcgcccctccaagtttaagcgaattggaaaaacgaattatatcacgcggcaca
gaatcggcagagcacatccaaaatcgtttgaaagcggcaaaagaagagctggaaatgatg
gatgcttacgattatgtcgtggaaaacgataaagtcgagctcgcgtgcgagcggattaaa
gcgatcgtgatggctgaacattgccggcgggaacgcgtggcaaaacgttataaaagaatg
ctgggggtggaataa

DBGET integrated database retrieval system