KEGG   Geobacillus thermoglucosidasius: Geoth_2896Help
Entry
Geoth_2896        CDS       T01531                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_2896
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geoth_2896
  Amino acid metabolism
   00310 Lysine degradation
    Geoth_2896
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Geoth_2896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2819835..2821109)
Genome map
AA seq 424 aa AA seqDB search
MAEVKVPELAESITEGTIAQWLKKPGEYVEKGESICELETDKVNVEIMAEESGVLQQILA
REGDTVAVGQAIAVIGEGQAAQPAAQEAASKATPEAAQEAAAVSTEEKQEQPVAAGTHPA
QRPVASPAARKIAREKGIDLTQVPTVDPLGRVRKQDVESFAQQQSRPQAAPAAPVPQPQQ
PAPSVAKQDDGKPVVREKMSRRRQTIAKRLLEVTQSTAMLTTFNEIDMSAVIALRKRKKE
KFFEEHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEIILKKYYDIGVAVSTDEGLVVP
VVRDCDRKNFAEIERDIAELAEKARNNKLSLSDLQGGTFTITNGGVFGSLFSTPLLNGPQ
VGILGMHAIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTIKDLIENPEDL
LLES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagtcaaagttccagaattagcagaatccattacagaagggaccatcgcgcaa
tggttgaaaaagcctggtgagtatgtggaaaaaggtgaatcgatttgcgaattggaaaca
gataaagtcaatgttgaaattatggcggaagaatccggagtattgcaacaaattttagca
agggaaggagacacagtcgccgtagggcaagcgatcgctgtcattggcgaagggcaggct
gctcagccggctgcacaagaagcagcaagcaaagcaacgccagaagcagcgcaagaagcg
gcagcggtcagcacggaagaaaaacaggaacagccagtcgcggctggcactcatccggca
cagcgcccggttgcttcgccggcagcgcgcaaaatcgcaagagaaaagggcattgattta
acacaagtccctactgttgatccgttaggccgtgtccgcaaacaagatgtggagtcattt
gcgcaacaacaatcaagaccgcaagcggcgccggcagcaccggttccgcagccgcagcaa
ccagctccatctgtagcgaaacaagatgacggcaagccggttgtccgcgaaaaaatgtcg
cgccgccgccagacgattgccaaacgtttattggaagtaacgcaatctacggcgatgttg
acgacatttaatgaaatcgatatgtcggcggttatagcattgcgaaaacggaaaaaagag
aaatttttcgaagagcacgatgtgcgcctcgggtttatgtctttctttgtaaaagcggcg
gtagcggcattgaaaaaatatccttacgtcaatgcggaaattcaaggtgatgaaattatc
ttgaaaaaatattacgatattggcgtcgctgtttccaccgacgaaggattggttgttccg
gtggtgcgcgactgcgatcggaaaaactttgctgaaatcgaaagagatattgctgaattg
gctgaaaaagcgcgcaacaataaactatcgctaagcgacttgcagggcggaacgtttacg
ataacaaacggtggagtgtttggttcgctgttttccactccgcttcttaatggaccgcaa
gtcggcattttaggaatgcatgccatcaagcttcgtcctgtggcaatcgacgaagagcga
atcgaaaatcgtccgatgatgtatgtcgcgttatcatatgatcatcgaattattgatgga
aaagaagcggttggctttttgaaaacgatcaaagacttgatcgaaaatccagaagatctt
cttttagaaagttaa

DBGET integrated database retrieval system