KEGG   Geobacillus thermoglucosidasius: Geoth_3108Help
Entry
Geoth_3108        CDS       T01531                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Geoth_3108
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_3108
  Lipid metabolism
   00071 Fatty acid degradation
    Geoth_3108
  Amino acid metabolism
   00350 Tyrosine metabolism
    Geoth_3108
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Geoth_3108
   00626 Naphthalene degradation
    Geoth_3108
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Geoth_3108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3023158..3024180
Genome map
AA seq 340 aa AA seqDB search
MKAAVVEQFKEPLKIKEVEKPSISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVEEVGPGVTHLKVGDRVGIPWLYSACGHCEYCLSGQETLCEHQENAGYSVDGGY
AEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTGTKPGEWVAIYGIGGLGHVA
VQYAKAMGLHVVAVDIGDEKLELAKELGADLVVNPAKENAAQFMKEKVGGVHAAVVTAVS
KPAFQSAYNSIRRGGTCVLVGLPPEEMPIPIFDTVLNGIKIIGSIVGTRKDLQEALQFAA
EGKVKTIIEVQPLEKINEVFDRMLKGEINGRVVLTLENNN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcagtagtagagcaattcaaggaaccattaaaaattaaagaagtggaaaag
ccatccatttcatatggcgaagtattagtccgcattaaagcatgcggtgtatgccatacg
gacttgcacgccgctcatggcgattggccagtaaaaccaaaacttcctttaatccctggc
catgaaggagtcggaattgttgaagaagtcggtccgggggtaacccatttaaaagtggga
gaccgcgttggaattccttggttatattctgcttgcggccattgcgaatattgtttaagc
ggacaagagacattatgtgaacatcaagaaaacgccggctactcagtcgacgggggttat
gcagaatattgcagagctgcggcagactatgtggtgaaaattcctgacaacttgtcgttt
gaagaagctgctcctattttctgcgccggagttactacttataaagcgttaaaagtcaca
ggtacaaaaccgggagaatgggtagcgatctatggcatcggcggccttggacatgttgcc
gtccagtatgcgaaagcgatggggcttcatgttgttgcagtggatatcggcgatgagaaa
ctggaacttgcaaaagagcttggcgccgatcttgttgtaaatcctgcaaaagaaaatgcg
gcccaatttatgaaagagaaagtcggcggagtacacgcggctgttgtgacagctgtatct
aaacctgcttttcaatctgcgtacaattctatccgcagaggcggcacgtgcgtgcttgtc
ggattaccgccggaagaaatgcctattccaatctttgatacggtattaaacggaattaaa
attatcggttccattgtcggcacgcggaaagacttgcaagaagcgcttcagttcgctgca
gaaggtaaagtaaaaaccattattgaagtgcaacctcttgaaaaaattaacgaagtattt
gacagaatgctaaaaggagaaattaacggacgggttgttttaacattagaaaataataat
taa

DBGET integrated database retrieval system