KEGG   Geobacillus thermoglucosidasius: Geoth_3126Help
Entry
Geoth_3126        CDS       T01531                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Geoth_3126
Enzymes [BR:gth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Geoth_3126
Peptidases [BR:gth01002]
 Cysteine Peptidases
  Family C44
   Geoth_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3043561..3045408)
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDFQRDLRTEKETIVKMTETLAKRGPDDTNVWLSEHAAFGHKRLIVVDPAGGK
QPMTRIKNGYHYTVCYNGELYNTEDIRKELLKKGYTFRGHSDTEVLLTAYMEWKERCVDY
LNGIFAFAIWDEQRGQLFLARDRLGVKPLFYRHVHDSLLFGSEMKAILAHPEVKAEVDYE
GLAEVFGLGPSRTPGHGVFRGMKELRPAHALTFSRKGIKVWRYWNVQSDVHRDSFGETVE
KLRFLLIDAVTRQLVSDVPVCTFLSGGIDSSSITAIAATVFAKEGKGQLHTYSIDYEGND
QYFKANDFQPNADAPWIELMSKTFQTVHHHCVISQEDLFHHLQEAVIVRDVPGMADVDSS
LLWFCKEIRKDFVVSLSGECADEIFGGYPWFHRPDDLARNGFPWMRSTEARMDLLKEDWR
KKLQLDEYVQKRFGETIAEVPRLEGESAEDAKRRELFYLNMIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYVWNIPWEMKMYGNREKGILRKALEGILPEEVLYRKKSPYPKTHHP
LYTKLVKNWVKELLHDRSSILYEFFDTKKLEELVETEGKSFQAPWFGQLMTGPQLLAYLG
QVHVWFQQYGITIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcaccggttgggttgattttcagcgcgatttgcggacagaaaaagagacg
atcgttaaaatgacagaaacgttggcgaaacgcggacctgacgacacgaatgtttggctt
agcgagcatgccgcatttgggcataagcgccttattgtggttgacccagcaggtggcaaa
cagccgatgacaagaataaaaaacgggtatcattataccgtttgttataacggagaactg
tacaatacggaagatattcgcaaagaattgttaaaaaaaggatatacgttccgggggcat
tcggatacggaagtattgttaaccgcttatatggagtggaaagaacgctgcgtcgactat
ttgaacggaattttcgcttttgcgatttgggacgaacaacgcggacagctgtttttagcg
cgagaccggctcggcgtaaaaccgcttttttaccggcatgtccatgatagtcttttgttt
ggctcagaaatgaaagcaattttggcacatccggaagtaaaagcagaagtggactatgaa
ggactagcagaagtgtttggattaggtccgtcacggacaccagggcatggcgtgtttcgc
ggaatgaaagaattgcgcccagcgcatgctctaacgttttcccgtaaaggaataaaagta
tggcgttactggaatgttcaaagcgatgtgcatagagattcgttcggtgaaacggtagaa
aaactccgttttcttcttatcgatgctgttacgcgccaacttgtttccgatgttcctgtc
tgcacttttttatccggcgggattgattcgagttccattaccgccattgccgcaacggtg
tttgcgaaagaaggaaaaggacagcttcatacgtattctattgattacgaagggaacgac
caatatttcaaagcaaatgattttcagccaaatgccgatgcgccttggattgaactaatg
tcaaaaacattccaaaccgtccatcatcattgtgtcattagtcaggaagatttgtttcat
catttacaggaagcggtgatcgtccgtgatgtcccaggcatggcggatgtggactcttcg
ttgctatggttttgcaaagaaataagaaaagattttgtcgttagtttatccggggaatgt
gcggacgaaatttttggcggctacccatggtttcaccgtcctgacgatttagcgcggaac
ggattcccttggatgcgttcgacagaggcacggatggatttattaaaagaagattggaga
aagaaattgcagctggatgaatatgtacaaaagcgctttggtgaaacgatcgcggaggtt
ccaagactggaaggggaaagtgcggaagatgcgaagcggcgcgaattgttttatttgaac
atgatttggtttatgacgacgcttttggatcgaaaagaccgcatgagcatgggcgcaagt
ttggaagtccgcgtgccgttcgccgatcatcgtctagtcgaatatgtgtggaacattccg
tgggaaatgaaaatgtatggcaaccgtgaaaaaggcattttacgcaaggcacttgagggg
attttgccagaagaagtgctctatcgcaaaaaaagcccgtatccgaaaacacaccatccg
ctttatacaaagttagtaaaaaattgggtaaaagaattactacatgatcgttcgtcgatt
ctttacgaatttttcgatactaaaaaattggaagaattagtagaaacagaaggtaaatcg
ttccaagcgccttggttcgggcagttaatgacagggccgcagctgttggcgtatctcggc
caagtgcacgtatggttccaacaatacggcattacgataaaggaatag

DBGET integrated database retrieval system