KEGG   Geobacillus thermoglucosidasius: Geoth_3165Help
Entry
Geoth_3165        CDS       T01531                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Geoth_3165
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Geoth_3165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3086255..3087691)
Genome map
AA seq 478 aa AA seqDB search
MNDEKYTVVIIGGGITGITAAYYLQKAVKERQLPIECKLVEATHRLGGKVQTVVRDGFVI
ERGPDSFLARKTSAFRLVREVGLENEIVHNATGKSYILVNGKLYSIPGGAIMGIPTQIGP
FITTRLFSPLGKLRAAFDFILPPTKAEGDLSLGQFFRRRLGDEVVDNLIEPLLSGIYAGD
IDQMSLMATFPQFFQIEQKYGSLVLGAKRTAPKAQKERKGAFQTLKTGLQSLVDEVEKRM
EQGSVIKGVRVERVWREGTGYRLRLSNGDIWKADSIIVAAPHSSVPAMFADYPFFEPFQS
IPSTSVATVALAFPESAIEQDIDGTGFVVSRRNDYTITACTWTHKKWPHTAPDGKALLRC
YVGRPGDEEIVEQSDDEIVRVVMDDLSKIMRISGRPELIAISRWKEAMPQYTVGHKERLA
KIKTHMDAELPGVFLAGSSYEGLGLPDCIDQGENAVKKVLDYLQTAPRKLAEVNSKMS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgacgaaaaatatacggttgtgattatcggaggcggcatcacaggaattactgct
gcatattatctgcaaaaagcggtgaaagaacggcagcttccaatcgaatgcaaactggtg
gaagcgacacaccgcttgggcggcaaagtgcaaacagtggtgcgcgatggctttgtcatt
gagcgcggccctgattcgtttttggcgcgaaaaacgagcgctttccgtcttgtgcgtgaa
gttgggctcgaaaatgaaattgttcataatgcgacgggaaaatcgtatattcttgtgaac
ggaaagctatattcgataccaggtggggccattatggggattccgacgcaaatcggacca
tttatcacgacaaggctgttttccccattaggaaagctgcgcgccgcttttgattttatt
ttgccgccgacaaaagcggaaggtgatttatcgttagggcaatttttccgccgccgtctc
ggagatgaggtggtggataacttaattgaaccgctgttgtcgggcatttatgccggcgac
attgaccaaatgagtttaatggcgacatttccgcaatttttccaaattgagcagaaatac
ggcagtctcgtgctcggagcgaagcggacggcgccgaaagcgcagaaagagcggaaaggt
gcgtttcaaacgttaaagacagggctgcaatcgttagtcgatgaagtggaaaaacggatg
gaacaaggcagcgtcattaaaggagtacgggtagaaagagtgtggcgcgagggaacggga
taccgtctgcgcttaagcaacggcgacatatggaaggcggacagcatcatcgtcgcggcg
ccgcattcgtctgtgccagcgatgtttgctgattacccgttttttgaacctttccaatct
attccatcgacatctgtcgcaactgttgcactggcctttccggaaagcgccattgaacaa
gatattgacggaaccggttttgtcgtttcccgccgcaacgattataccattaccgcctgc
acatggacacataaaaaatggccgcataccgcgccggatggaaaagcgttgttgcgctgc
tatgtcgggcgccccggcgatgaagaaatcgttgagcagtccgatgacgaaattgtccgt
gtcgtgatggatgatttaagcaaaattatgcgcatttccggacgtccagagcttattgct
atctcgcgatggaaagaggcgatgccgcaatatacagtggggcataaagagcggcttgcg
aaaataaaaacacatatggatgcggaacttccaggcgtgtttttggcgggaagttcatat
gaaggattaggactgccagattgcattgaccaaggggaaaatgcggtgaaaaaagtgctt
gattatttgcaaacggccccgcggaaactggcggaggttaactcaaaaatgagttaa

DBGET integrated database retrieval system