KEGG   Geobacillus thermoglucosidasius: Geoth_3850Help
Entry
Geoth_3850        CDS       T01531                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Geoth_3850
Enzymes [BR:gth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Geoth_3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3788823..3789707)
Genome map
AA seq 294 aa AA seqDB search
MRFDEAYSGNVFIKSHPDFAESEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELGEVKYFDAGDIPLPFGNAQRSLDMIEDFVDKILAADKFPLGIGGEHLVSWPVIK
AVYKKYPDLAVIHMDAHTDLREQYEGEPLSHATPIRKVAELIGPTNVFSFGIRSGTKEEF
QWAKDNGMYIAKFEVLEPLREVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLAAIHEIAKSNIRVVGADLVEVAPIYDHSEQTANTASKLIREMILGWVQKRNA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgatgaggcgtattcgggcaacgtttttattaaaagccatccagattttgcg
gaaagcgaagcggtcatttacggaatgccgatggactggacggtaagttaccgccctggt
tcccgcttcggcccggcccgcattcgcgaagtgtcgatcgggttggaagaatatagccca
tatttagatcgtgagcttggggaagtaaaatattttgatgcgggcgatattccgcttccg
tttgggaacgcgcagcgcagcttggatatgatcgaagatttcgtggataaaattttagcg
gccgataaattcccgctcggcatcggcggcgagcatctcgtctcgtggccggtcattaaa
gcggtgtataaaaaatatcctgatttggcggtcatccatatggacgcccatacggatttg
cgcgaacaatacgaaggggagccgctttcccatgcgacgccgatccgcaaagtcgcggag
cttataggcccgacaaacgtattttcgttcggcattcgttcaggcacgaaagaagagttt
caatgggcgaaagataacgggatgtacatcgccaagtttgaagtgctcgagccgcttcgg
gaagtgctgccaaagcttgccggccgccctgtctatgtcacgattgacatcgacgtgttg
gaccctgcccacgctccggggacgggaacggtcgatgccggcggtattacgtcgaaagaa
ctgctggcggcgattcacgaaatcgccaaatcgaacatccgcgtcgtcggagccgatttg
gtggaagtagctcctatctacgaccattcggagcaaaccgccaatacagcaagcaaactt
attcgcgaaatgattctcggctgggtgcaaaaacgcaatgcgtaa

DBGET integrated database retrieval system