KEGG   Geobacillus thermodenitrificans: GTNG_0071Help
Entry
GTNG_0071         CDS       T00496                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GTNG_0071
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GTNG_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82786..83313
Genome map
AA seq 175 aa AA seqDB search
MENIVYISLGSNLGDRVYYLRSAIEALDRYEGISVKSSSSIYETDPVGYVHQDKFLNMVV
EVATTLSPFSLLNVTQQIEQEFGRKRGIRWGPRTLDLDILLYNHENIETEQLVIPHPRMA
ERAFVLIPLLEINSHLTIPNIFEPLTDIVDRLPDKEGVRVWKQKDGEDVFALFES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacattgtatatatttccttaggttctaacttaggggatcgtgtctattattta
cgttcggccattgaagcacttgatcgctacgagggaatttctgtaaagtcgagttcgtcc
atctatgaaacggatccggttggttacgtccatcaagacaagtttttaaacatggtagtc
gaggtggcgacgacgttgtcaccattttccttgttgaacgtgacgcaacaaattgaacag
gaatttgggagaaaaaggggaattcgctgggggccgcgtacgttagaccttgacattttg
ctgtataatcatgaaaatattgaaacagagcaactagtcattccgcatccgcgtatggcg
gagcgggcgtttgttcttatcccgttgctcgaaatcaattcccatttaacaataccgaac
attttcgagccgttaacagacatcgttgatcgactacctgacaaagaaggagttcgcgta
tggaagcagaaagatggggaagacgtattcgcgcttttcgaaagctaa

DBGET integrated database retrieval system