KEGG   Geobacillus thermodenitrificans: GTNG_0171Help
Entry
GTNG_0171         CDS       T00496                                 

Definition
alkaline phosphatase-like protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GTNG_0171
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GTNG_0171
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GTNG_0171
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GTNG_0171
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTNG_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184190..184798
Genome map
AA seq 202 aa AA seqDB search
MQAWITEFMEQFGYIGIFFMIALENIFPPIPSEVILPFGGFMTTYTTLTIPGVIAAATAG
SVVGAIVLYGIGRLLSVERLERIVDRWGGWLRVKPEDIAKANRTFQRYGVWAVFLGRMIP
LVRSLISIPAGMSKMNIGLFVWLSVLGTLIWNTLLISIGAALGQSWEKVSEVIGMYAEVV
YVIIAIIILVAAVRFWKRRRAS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcgtggattactgagtttatggaacagttcggctatatcggcatctttttcatg
atcgcacttgaaaatatatttccgcccattccatcggaagtcattttgccgtttggcgga
tttatgacgacatacacaacattgaccatccctggcgtcatcgcagcagccactgccggg
tcggtcgtcggggcgatcgtgctgtatggtatcggtcggttgttgtcggtcgagcggctc
gagcggatcgtcgaccgctggggcggatggctgagagtgaagccagaagatatcgccaag
gcgaaccggacatttcagcgctacggagtgtgggcggtattccttggtcgtatgattcca
ttggtgcgcagtttgatttcgattcccgctggcatgtcgaaaatgaatatagggctgttt
gtctggctgtcggtgttgggaacactcatttggaatacgcttttaatctcgatcggggcg
gcgctcggccaatcgtgggaaaaagtatctgaagtgattgggatgtacgccgaagtggtg
tatgtcattattgctataattattttggttgcagctgtccgcttttggaaacggcgtcgg
gcttcttag

DBGET integrated database retrieval system