KEGG   Geobacillus thermodenitrificans: GTNG_0180Help
Entry
GTNG_0180         CDS       T00496                                 

Gene name
frnE
Definition
(GenBank) FrnE protein
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
gtn  Geobacillus thermodenitrificans
Brite
Enzymes [BR:gtn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GTNG_0180 (frnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5 Thioredoxin_3
Motif
Other DBs
NCBI-ProteinID: ABO65564
UniProt: A4IJR0
Position
193613..194320
Genome map
AA seq 235 aa AA seqDB search
MNIEIWSDFVCPFCYIGKRRLEQALEQFPHRKDVTVVFRSFELDPNAPKETPLTIHEIIA
QKYGITVEEAKRANADIGRQAEAVGLTFRFETMKPTNTFDAHRLAQYAKEKGKLQDVVEQ
LFFAYFTESKHISDRDVLLDIAEAAGLDRSETEAVLDGDRYTEQVREDEAEAAQLGVRGV
PFFVLNRKYAISGAQPIEVFRQALEKVWEEEQQASSLQPLADEGGACTDGNCSID
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaaatttggtctgactttgtctgtccgttttgctatatcggcaagcgccgt
ttggaacaggcgcttgaacagtttccacatcgaaaagacgttacggtcgtattccgcagc
tttgagcttgacccgaatgcgccaaaagagacgccgttaaccatccatgaaatcattgcg
caaaaatacgggattacggtggaggaagcgaagcgggcgaacgccgatattggcagacaa
gcggaagcagttggtttgacgtttcgcttcgagacgatgaagccgacgaatacgtttgac
gcccaccgtctggcgcaatacgccaaggaaaaagggaagctccaggacgttgtcgaacag
ctgttttttgcgtatttcaccgaatcgaagcacattagcgaccgagatgtgctccttgat
atcgccgaagcggctgggcttgatcgaagcgagacggaagcggtgcttgatggcgaccgc
tacacggagcaagtgcgggaagacgaggcagaagcggcccagctcggtgtccgcggtgtt
ccatttttcgtccttaaccgtaaatatgcgatttccggcgctcaaccgatcgaagtgttt
cgtcaagcgctagagaaagtatgggaagaggaacaacaagcttcatctttgcagccgctc
gctgacgaaggcggggcatgcacggacggaaactgctcgatcgactaa

DBGET integrated database retrieval system