KEGG   Geobacillus thermodenitrificans: GTNG_0338Help
Entry
GTNG_0338         CDS       T00496                                 

Gene name
manB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_0338 (manB)
   00030 Pentose phosphate pathway
    GTNG_0338 (manB)
   00051 Fructose and mannose metabolism
    GTNG_0338 (manB)
   00052 Galactose metabolism
    GTNG_0338 (manB)
   00500 Starch and sucrose metabolism
    GTNG_0338 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    GTNG_0338 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    GTNG_0338 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GTNG_0338 (manB)
Enzymes [BR:gtn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GTNG_0338 (manB)
    5.4.2.8  phosphomannomutase
     GTNG_0338 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384567..385976
Genome map
AA seq 469 aa AA seqDB search
MNTSITKPFAWPTHVFKEYDIRGRAGEELDESFAYWLGRAFAEMMQNEGERKAVVAHDNR
LSSPALHRSLKNGLLDGGCDVIDIGLSTTPMFYYSLYNTDISCGMIVTASHNPGDENGFK
IAMGKTTIYGERIQALRKAMERLSQQQAQPEVTRGREETLDLVPAYIKMLKEKIQLGPRQ
LKVVVDCGNGTPSIIAPKVLKEWGCDVIPLYCESDPTFPNHHPDPVVPENLADLIKTVRK
EQADLGIAFDGDGDRIGIVDETGTIRWGDQLMVLFWRDILKRHPGAEAPVEVKCSQALVE
EIERLGGRPFFHRTGHSHVKATLRRRPAIPFAGEMSGHLFFNDEFYGYDDALYAAGRLLR
LLSHDKRPLSEWFADVPYYVATPETRVTCPEEKKPVAIDAVKKRFASRYPVVDVDGARIQ
FREGWGLVRPSNTQPILVLRAEAKTEEALAEIKRQLADCLHTLELHVNW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgtcgataacgaaaccgttcgcatggccaacacacgtatttaaagagtatgac
attcgcgggcgtgccggcgaggaacttgatgagtcgtttgcttattggcttggacgggcc
tttgctgaaatgatgcaaaatgagggcgaacggaaggcggttgttgcccatgacaaccgc
ctgtcgtcgccggcgctgcatcgatcgttgaaaaacgggttgcttgatggcggctgtgat
gtcatcgatattgggctttcgacgacaccgatgttttactacagcttatacaacacggac
atttcatgtggcatgatcgttaccgcaagccacaacccaggcgatgagaacggatttaaa
atcgccatgggaaaaacaacgatttatggcgaacgcattcaagcgctgcgaaaggcgatg
gagcggctaagccaacaacaggcacaacccgaagtgacgcgggggcgtgaggaaacgctt
gacctggtcccggcatatatcaagatgttgaaggagaaaattcagctcggtccacgtcag
ctgaaagtcgttgtcgactgcggcaacggcaccccgtcgatcattgcgccaaaagtgctc
aaagaatggggctgtgatgtcatcccgctctattgtgaatccgatccgacgttcccgaat
caccatcctgacccggttgtgccggaaaacttagctgatttgatcaaaacggtgcgcaag
gagcaggcggatctaggcatcgcatttgacggtgacggcgaccggatcggtatcgtggat
gaaacgggcacgatccgctggggcgaccaactgatggtattgttctggcgtgatattctc
aagcgccatccgggagctgaggcgccggttgaggtaaaatgttcgcaagcgctcgtagaa
gaaattgagcggctcggcggccggccgtttttccaccgtaccggtcattcacacgtaaaa
gcgacgttgcgccgccgaccggccattccgtttgccggcgagatgtccgggcacttattc
ttcaatgatgaattttatggttacgatgacgccttgtacgctgcgggacggctgcttcgc
ctcttgtcgcatgacaagcgcccactctctgagtggtttgctgatgtgccgtattatgtg
gcgacgccggaaacgcgtgtcacctgcccagaggagaaaaaaccggtggccatcgacgct
gtgaaaaaacggtttgccagccgttatccggtcgtcgatgtcgacggtgctcgtattcaa
ttccgtgaaggctggggattggtgcgtccttcgaacacgcaaccgattcttgtcttgcgc
gctgaagcgaagacggaagaagcgttggcggagattaaacggcagttggctgattgtttg
catacgctcgagcttcacgtcaattggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system