KEGG   Geobacillus thermodenitrificans: GTNG_0571Help
Entry
GTNG_0571         CDS       T00496                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GTNG_0571
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GTNG_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631996..633438
Genome map
AA seq 480 aa AA seqDB search
MSEEKRTVVIIGGGITGLTAAYYLQKAIKEQRLPLTCKLVEATHRLGGKVQTVIRDGYVI
ERGPDSFLARKTSAFRLVKEVGLEHEIVHNATGKSYILVNGQLYPIPGGAVMGIPTRIAP
FLTTGLFSPVGKLRAALDFVLPPVKTNGDMPLGQFFRRRLGDEVVDNLIEPLLSGIYAGD
IDEMSLMATFPQFFQLEQKYGSLVRGAKRTTPKEQKERKGAFQTLKTGLQSLVEEVEKRL
EPGSVIKGTRVERITRAGSVYRLQLSTGETWEADSVIITVPHHIVPDMLADYPFFAPFRS
VPLTSVATVALAFPEKAIRQDIDGTGFVVSRRSDYTMTACTWTHKKWPHTTPPGKALLRG
YVGRPGDEDIVDQPDDEIVRIVLDDLNKVMKIDGHPEFAVISRWKRAMPQYTVGHRERLA
AIKQHMAAELPGVFLAGSSYEGLGLPDCIDQGEKAVRDVLDYLRQGESNRSAEAVYSSAQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagaaacggacggttgtcattatcggcggtggcattactggtctcactgct
gcctactacttgcaaaaagcgatcaaagaacagcgtctgccgctgacatgtaagcttgtc
gaagcaacacaccggctcggtggaaaagtgcagacggtcatccgtgacggctatgtcatt
gagcgtggcccagactcttttttggcaaggaaaacgagcgcgttccgtcttgtaaaggaa
gttggccttgaacatgaaatcgtccacaatgcgactgggaaatcgtacattttagtaaac
ggccaattatatccgatcccaggcggagcggtgatgggcattccgacgcgcatcgccccg
tttttaacgactgggctgttttctccagtcggcaagctgcgagcggcactcgatttcgtg
ttgccgccggtgaaaacaaacggtgacatgccgctcggccaattttttcgccgccgttta
ggcgacgaagtggtggacaatttgatcgaaccgctgctgtctggcatttatgccggtgac
attgacgaaatgagtttaatggcgacgttcccacagttttttcagctcgaacaaaaatac
ggcagcctcgttcgaggagcaaaacgaacgacgccaaaagaacagaaagagcgaaaagga
gcgtttcagacattaaaaaccggcttgcagtcgctcgttgaagaagtggaaaagcggctt
gaaccgggcagtgtcatcaaagggacgcgtgtcgagcggatcacccgggctggttcggtg
taccgtcttcaattgagcactggtgaaacatgggaggcggacagcgtgatcatcactgtg
ccgcaccacattgtaccggacatgctcgctgattatccgtttttcgccccatttcgttcg
gtaccgctgacatcggtggcgacggtggcgcttgcttttccggagaaagcgatccgccaa
gatattgatggcactgggtttgtcgtctcgcgacgcagcgattacacaatgacggcgtgc
acgtggacgcataaaaaatggccgcatacgacaccgcctggcaaagcgcttttgcgtggc
tatgtcggacgaccgggggatgaagacatcgttgatcagccggacgatgagatcgtccgc
atcgtgcttgatgacttaaacaaagtgatgaaaattgatggccatccggaatttgccgtc
atctcccgttggaagcgggcgatgccgcaatatacagtcgggcatcgagagcggctggcg
gcgattaagcagcatatggcggcggagctgccaggggtgtttttagctggcagctcctat
gaaggtctcggattgcctgattgcattgatcaaggggagaaggcggtccgtgatgtgctt
gattatttgcggcaaggggaatcaaaccgatcggcagaagccgtgtacagcagcgctcaa
taa

DBGET integrated database retrieval system