KEGG   Geobacillus thermodenitrificans: GTNG_0583Help
Entry
GTNG_0583         CDS       T00496                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00630  Glyoxylate and dicarboxylate metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01200  Carbon metabolism
Module
gtn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GTNG_0583
Enzymes [BR:gtn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GTNG_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABO65965
UniProt: A4IKW1
Position
645691..646977
Genome map
AA seq 428 aa AA seqDB search
MASFAERVRQLEESWKNEERWKGVVRPYSAEDVIKLRGSLDIEHTLARRGAEKLWKLLNT
EDYVHALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGHMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAVRNLIAARLAADVMGVPTVLIARTDANAADLITSDIDP
RDQQFITGERTTEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLDEARRFAEAIHE
QFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKFQFVTLAGFHALNYSMFELAR
GYKDRGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVALKGST
EEEQFTTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatttgctgaacgtgtccgacaattggaggaaagttggaaaaatgaagagcgc
tggaaaggggtcgtccgtccgtacagcgccgaagatgttattaaactgcgcggctcgctt
gatattgagcatacgctcgctcgacgcggagctgaaaagttatggaagctgttaaatacg
gaagattacgttcatgcgctcggtgcgttgaccggaaatcaagccgtgcaacaagtgaaa
gctggattgaaggccatttacttaagcggctggcaggtagcggccgatgccaacctcgca
ggacatatgtatccggatcaaagcttgtatccgtccaacagcgttccgcatgtagtcaaa
cgtattaaccaagcgttgcaacgtgcagatcaaatccaatatttagaaggtagtggagat
gttgactattttgtgccgatcgttgctgacgcggaagctggattcggcggccagctgaac
gtgtttgagctcatgaaagcgatgatcgaagccggggcggccggcgtccatttcgaagat
cagctgtcgtcggagaaaaaatgcggccatttaggtgggaaagtgctcttgccgacgcaa
acggcggtgcgcaacttgatcgcagcgcggcttgctgctgacgtcatgggtgtcccgact
gtgctcatcgctcgcaccgatgcgaatgctgctgacttgatcacaagcgacattgacccg
cgcgatcaacagtttattaccggcgaacggacgacggaagggttttatcgcacacgggca
ggcctcgaccaagcgatcgctcgcggacttgcttacgcgccgtatgccgaccttatttgg
tgtgaaacgagcgaaccaaatttggatgaagcacgccgattcgcggaagcgattcacgag
caatttccaggtaagctgctcgcgtacaactgctcgccgtcatttaactggaagaaaaaa
ttggacgacgaaacgatcgccaaattccagcaagagctcggtaaaatgggatacaagttc
caattcgtcactctcgccggcttccatgcgctcaactacagcatgtttgagttggcacgc
ggctacaaagatcgcggcatggcagcatacgccgaactgcagcaagccgaatttgccgct
gaaaagtacggctacacggcaacgcgccatcagcgtgaagttggtactggctatttcgat
gaagtcgctcaagtcatctccggcggccagtcgtccacagtcgccttaaaagggtcaact
gaggaggaacagtttacaactgcttaa

DBGET integrated database retrieval system