KEGG   Geobacillus thermodenitrificans: GTNG_0607Help
Entry
GTNG_0607         CDS       T00496                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gtn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
671821..673668
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVHFGRDLRRKQEVITRMTETLAKRGPDDTNTWLDTHAAFGHKRLVVIDPAGGK
QPMIRNKNGHRYTIVYNGELYNTEDIRKELLHKGYRFDGHSDTEVLLAAYIEWKEQCVDR
LNGIFAFAVWDEERELLFMARDRLGVKPLFYRQQAEELLFGSEVKAILAHPDVKAEVSYE
GLAEVFGLGPSRTPGHGVFYGVQELRPAHALTFSRTGLRVWRYWNVESDVHRDSLGETIE
KLRFLLTDAVTRQLVSDVPVCTFLSGGVDSSAITAIAANAFAANGKGPLHTYSIDYEGND
QYFQANDFQPNTDAPFIEQVSNKFQTIHHRCVITQEELFQHLRDAVIVRDVPGMADVDSS
LLWFCKQIREQFVVSLSGECADEIFGGYPWFHRPDDLARKGFPWMRSIEARIGLLKEEWR
KKLRLDDYVQMRYEETLVEVPRLEGESAEAAKRRELFYLNMIWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYVWNIPWEMKMYGGREKGILRKALEGLLPQDVLYRKKSPYPKTHHP
LYTKLVKQWLKQLLRDRSSILHEFFDQEKLTALVESGGKSFQVPWFGQLMTGPQLLAYLG
QVHVWFDHYGIHIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcactggctgggtgcatttcgggcgtgatttgcgccgtaagcaagaggtg
attaccaggatgacggagacgctcgctaaacgtggaccggacgatacgaatacatggctc
gacactcatgctgcgttcggtcataagcggctcgtcgttattgacccggccggcggcaaa
cagccgatgatccggaacaaaaacggacaccgctacacgatcgtttacaacggtgagcta
tacaatacggaagacatccgtaaagaactgttgcacaaaggctaccggtttgacggccat
tctgatacagaagtgctgctcgccgcttatatagagtggaaagaacaatgtgtcgatcgg
ttaaacggtatttttgcctttgctgtttgggatgaggagcgggaactgttatttatggcg
cgtgaccgtcttggagtcaaaccattgttttaccgtcaacaggctgaagagttgctgttc
ggctccgaagtgaaggcaattttagctcaccctgatgtaaaagcagaagtcagttatgaa
gggttagcggaggtatttgggctcggtccgtcgcgcacaccgggacatggagtattttat
ggtgtccaggaactgcgcccggcgcacgcgttaaccttctcccgtaccgggcttcgcgtc
tggcggtactggaacgtcgaaagcgatgtccatcgtgattcgctcggggaaacgatcgag
aagctgcgttttttattgaccgatgctgtcacacgccagctcgtttccgatgtgccggta
tgcacctttttgtcgggcggcgttgattcaagcgccattacagcgattgccgccaacgct
ttcgccgctaacgggaaaggaccgctccatacgtactcgatcgattatgaaggaaacgat
caatattttcaggcgaacgattttcagccaaatacagatgcgccgtttattgaacaagtg
tcaaacaagtttcaaacgatccaccatcgctgcgtgatcactcaagaagagctgttccaa
catttgcgtgatgcagtgatcgtccgtgacgttccaggcatggctgatgtcgattcttcg
ctcctttggttttgtaaacaaattcgtgagcagtttgtcgtgagtttatctggagaatgt
gcggatgaaattttcggcggctatccgtggtttcatcgtccagatgacttagcaagaaaa
gggtttccgtggatgcgctcgattgaagctcgcattggcttgttaaaagaagaatggcgg
aaaaaacttcgccttgacgactacgtgcaaatgcgttatgaagaaacgcttgttgaagtg
ccgcgtcttgaaggggaaagtgccgaggcggcgaagcggcgtgaactgttttacttaaat
atgatttggtttatgacgacactgcttgaccggaaagaccgaatgagcatgggggcgagc
cttgaggtacgtgtgccgtttgctgatcaccggctcgttgaatatgtttggaatatccca
tgggaaatgaaaatgtacggaggacgagaaaaaggtattttgcgcaaagcacttgaaggg
ctgcttccgcaagacgtgctctatcgaaagaaaagtccgtacccgaaaacacaccatccg
ctgtatacgaagttggtgaagcaatggctcaagcaactgcttcgtgatcgttcttctatc
ttgcacgagtttttcgatcaagaaaaactgacggcgcttgtcgaatcgggagggaagtcg
ttccaagtgccatggtttgggcaactcatgaccggaccacagctgcttgcttatcttggc
caggtgcatgtttggtttgaccattacggcattcatattaaagaataa

DBGET integrated database retrieval system