KEGG   Geobacillus thermodenitrificans: GTNG_0619Help
Entry
GTNG_0619         CDS       T00496                                 

Definition
(GenBank) Pyruvate dehydrogenase E2 (dihydrolipoamideacetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00020  Citrate cycle (TCA cycle)
gtn00620  Pyruvate metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Module
gtn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_0619
   00020 Citrate cycle (TCA cycle)
    GTNG_0619
   00620 Pyruvate metabolism
    GTNG_0619
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GTNG_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H Sec20
Motif
Other DBs
NCBI-ProteinID: ABO66001
UniProt: A4IKZ7
Position
688556..689866
Genome map
AA seq 436 aa AA seqDB search
MFVEVTLPKLSDSHDESLITFWHVSEGDAVEKGATLVEVQTEKAVSEIHAPESGTVKEIK
KKRGDTAKVGEVLAVLAVEAFAPDSGGPQIEIKITPRVKKLAKELGVDWRAITPTGANGK
ITEDDIRRSVSTRRQEVSQKKIVAAPSVRKFAREQNVPLEEVTPSGKNGRILKSDIEAVL
SVQQRKATDEAAASVEIVKKQESQEKVRRVPLTGIRKAITQAMVRSTRTIPQVTHFSEAN
ATRLVQHRQRIKPLAEQQGMKLTYLVYVIKALAAVLKKYPMLNASLDEEQEEIVIHESIH
IGFAVDTDRGLLVPVIRDADQKSLFQIAKEIEELSAKARTGAIQAAEMSGGTCTVSNIGS
ANGSWFTPIIHYPQSCILGIGKIDKKPIVINDSIEISFVMPLSLTYDHRLIDGVMAQHAL
NECQTYLSEPDWLFVM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtcgaagtgacattgcccaaactatccgattcccatgatgaaagtttaattacg
ttttggcacgtttccgaaggagatgcggtggaaaaaggagccacgctagtggaagtgcaa
accgaaaaggccgtttcagaaattcacgctcctgagtcgggaacagtaaaagagatcaaa
aagaaacgaggggatacggcaaaggtgggagaagtgctggctgtccttgccgttgaagcg
tttgctccggacagcgggggtccgcagatagagatcaagatcaccccgcgcgtaaaaaaa
ttggccaaggagcttggtgtcgattggcgtgcgatcacaccgacaggagcgaatggcaaa
atcacggaagacgatattcgtcgttcggtgagcacgagaagacaagaggtttcacaaaaa
aaaattgtggctgccccatcagtgcgaaagtttgctcgcgagcagaacgtgccgttagag
gaagtcactccgagcggaaagaacgggagaatattgaaaagcgatattgaagcggtatta
tcggttcagcaacgaaaagcaacagatgaagctgctgccagtgttgagattgtcaagaag
caggaaagccaagaaaaagtgcgtcgagtgccgttgacaggcatccgtaaggctatcacc
caagcgatggtgcggtcaacgcggactattccacaagtcacccattttagcgaggccaat
gcgacccgacttgttcaacatcgtcaacggatcaaacctctagcagagcaacaagggatg
aaactgacctatttagtctatgtgataaaagcgctggcagctgtgttaaaaaagtatcca
atgctcaatgcttcccttgatgaggaacaagaggaaattgtcattcatgaatcgattcat
attgggtttgcggttgacactgatcgaggattgctcgttccagtgattcgtgacgcggat
caaaaatcgttgtttcagattgccaaagaaatcgaagaattgtcagcgaaggcaagaacg
ggggcgattcaagcagcggagatgtccggagggacgtgcacggtttcaaacatcggctcg
gccaacggctcgtggttcacgccgattatccattatccgcagtcttgcattttaggaatc
ggtaaaattgataaaaagccaatagtcatcaatgactcgattgagatctccttcgtgatg
ccgctatcccttacttatgatcatcgtctgatcgatggggtcatggcgcaacatgcccta
aatgaatgtcaaacctacttgtctgaaccagattggctgttcgttatgtga

DBGET integrated database retrieval system