KEGG   Geobacillus thermodenitrificans: GTNG_0790Help
Entry
GTNG_0790         CDS       T00496                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GTNG_0790
Enzymes [BR:gtn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GTNG_0790
Peptidases [BR:gtn01002]
 Cysteine Peptidases
  Family C44
   GTNG_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862889..864796
Genome map
AA seq 635 aa AA seqDB search
MCGFIGCVHDHPRIRNKKWNEMFQLMNGLITHRGPDDEGYFFDDYVSFGFRRLSIIDLEA
GHQPLSYENERYWIIFNGEIYNYIELREELLAKGHQFATHSDTEVIVALYSVEKEKAVER
LRGMFAFVIWDKQEKSVFAARDPFGIKPFFYAEQEGRTFFASEKKSILFALGHESLEHDS
LQHYLTFQYVPEPLTMSSGIYKLEPGHYIKKKVGEPLTVHRYWKASFQPVRQSEEELVKQ
IREALFDSVNVHMRSDVPVGAFLSGGIDSSLIVAIAKQFHPHLKTFSVGFEREGFSEIDV
AKETAEKLGVDNISYVISPQEYMDELPKIMWHMDDPLADPAAVPLYFVAREARKHVTVVL
SGEGADELFGGYNIYREPQSLRLFERMPDVVKAVLRMIAKLLPDGMKGKSFLERGTTPLE
ERYVGNAKMYSENEKEALLKTYQKGREYTTITAPFYEETSHYPPVNRMQYIDIHTWLRGD
ILLKADKMTMAHSLELRVPFLDRKVFEVASKIAPDMKTANGTTKYILRKAAEGIVPDHVL
NRKKLGFPVPIRHWLRNEMYDWARRLIYESETDHLFHKDVLYRLLDEHAQQKADHSRKLW
TVLAFMIWHQVYVEKKYDFALSVQDEKWSTSVLEA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctttatcggttgtgttcacgatcatccgcgaataagaaataaaaaatggaac
gaaatgtttcaactaatgaacggtcttattacccatcgcggtcctgatgatgaagggtat
ttttttgatgactacgtgtctttcgggtttcgacgtttaagcattatcgatttggaagca
gggcatcagccgctctcttacgaaaacgaacgctactggatcatctttaacggggaaatc
tacaactatattgaattgcgggaagaactgttggcgaaggggcatcaattcgcgacgcac
tctgatactgaagtgattgttgctctttatagcgtggaaaaagaaaaagcagtcgaaagg
ctgcgcgggatgtttgcgtttgtcatttgggacaagcaagagaaatcggtgtttgcggcg
cgggacccgtttggtattaagccatttttttatgcggaacaagagggtcgcacatttttt
gcttcagaaaagaaaagcattttgtttgcgttggggcatgaatcattggagcatgattct
ctacaacattatttaaccttccaatacgtccctgagccattgacgatgtcgtctggcatt
tacaagttggaaccagggcattatatcaagaaaaaagttggggaaccgctcaccgttcac
cgttattggaaagcatccttccagcctgttcgccaatcggaagaggagcttgtgaaacaa
attcgcgaggcgctgtttgattcggtgaacgtgcatatgcgcagcgatgtgccggttgga
gcgtttttgtcaggcgggattgactcatcgttgatcgtggccatcgccaagcaattccat
ccgcatcttaagacattttctgtcgggtttgagcgggaagggttcagcgaaattgatgtt
gccaaagaaacggcggagaagctcggtgtggacaatatcagctatgtcatctccccgcag
gagtatatggacgagcttccgaaaatcatgtggcatatggatgacccattagctgatccg
gcagctgtgccgctctattttgtggcccgtgaggcgagaaaacatgttacggtcgtgctt
tccggtgagggggcagacgagctgtttggcggttacaatatttatcgcgaaccgcagtca
ctgcggctgttcgagcggatgccagacgtggtgaaagctgtgttgcggatgatcgcgaag
cttcttccggatggaatgaaaggaaaaagtttcttagaacgcgggacgacgccgctcgag
gaacggtatgttggcaatgcgaaaatgtatagcgaaaacgaaaaagaggcattactcaaa
acatatcaaaaagggcgcgagtatacaacgattacggctcccttttatgaagaaacgtct
cattaccctccggtcaaccggatgcaatacattgacattcatacatggctaagaggcgat
attttattaaaagcggataaaatgacgatggctcattcgctcgaactgcgggttccattt
ttagatcgaaaggtgtttgaagtcgcatccaaaattgctcctgacatgaaaacagccaac
ggtacgacaaaatacattttgcgcaaggccgctgaaggcatcgtgccggatcatgtgtta
aaccggaagaaactagggttcccggtgccgattcgccattggctgagaaatgaaatgtat
gactgggcaagacgacttatctatgaaagtgaaactgaccatttgttccataaggatgtg
ctataccgtttgctcgatgagcacgcccagcagaaagcggatcatagtcgcaagctgtgg
accgtcttggcgtttatgatctggcaccaagtctatgtagaaaagaaatacgattttgct
ttatctgtacaagacgaaaagtggtcaacatctgttttggaggcatag

DBGET integrated database retrieval system