KEGG   Geobacillus thermodenitrificans: GTNG_0886Help
Entry
GTNG_0886         CDS       T00496                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTNG_0886
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTNG_0886
  Amino acid metabolism
   00310 Lysine degradation
    GTNG_0886
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GTNG_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962218..963537
Genome map
AA seq 439 aa AA seqDB search
MMTNGMFEEGINVAEIKVPELAESITEGTIAQWLKKPGDYVEKGESVCELETDKVNVEIM
AEESGVLQQLLANEGDTVAVGQAIAIIGEGAASAPTAAPQAAQPTDETPTVPADRAEQQA
PQPVAVAQAPGQRPVASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAGSQ
AAPQPAPTAAPVSVPTQASAPSAESGKLVIREKMSRRRQTIAKRLLEVSQSTAMLTTFNE
IDMSAVMELRKRKKDKFLEEHDVRLGFMSFFVKATVAALKKYPYVNAEIQGDEILLKKYY
DIGVAVSTDEGLVVPVVRDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGG
VFGSLLSTPLLNGPQVGILGMHSIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVG
FLKTVKDLIENPEDLLLES
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaacggaatgtttgaggagggcatcaacgtggctgagatcaaagtcccagaa
ctagcagagtccatcaccgaaggtacgatcgctcaatggctgaaaaagccgggcgactat
gtggaaaaaggtgaatcggtttgtgagttagaaacagataaagtgaacgtcgaaattatg
gccgaagagtcgggagttttacagcaattgttggcgaacgaaggtgacacggtcgctgtc
ggccaagcgatcgccattatcggcgagggggcggcttcggcaccgactgctgctccgcag
gctgcgcagccaactgacgaaacaccaaccgtgccggctgaccgcgccgagcaacaagca
ccgcaaccggtcgctgtcgcccaagcaccgggccaacgtccagtcgcttcgccggccgct
cgaaaaatggcgcgtgagaaagggattgatttgacgcaagtgccgaccgttgatccgctt
ggacgcgtccgcaagcaagacgtggcttcatttgccgctcaaccagcagctggttcacaa
gcagcgccgcaaccggctccaacggctgcgccggtttctgtgccaacacaggcttctgcg
ccgtcagcggaaagcggcaagctggtcatccgtgaaaaaatgtcgcgccgccggcaaacg
atcgccaagcgattgcttgaagtttcgcaatcgactgcgatgctgacgacgttcaatgaa
atcgacatgtcagccgttatggaattgcgcaagcggaaaaaagacaagtttttagaagag
catgacgtccgccttggctttatgtcgtttttcgtcaaagcgacggtggcagcgctgaaa
aaatatccatacgtcaacgcggaaattcaaggcgatgaaattttgctgaaaaaatattac
gacatcggcgtggctgtttcgaccgatgaagggcttgttgtcccagttgtgcgtgactgt
gaccggaaaaacttcgctgaaattgagcgagacatcgctgaattagcggcgaaagcgcgc
agcaacaaactgtcgcttgccgatttgcaaggcggtacgtttacaatcaccaacggtggt
gtattcggctcgcttctttcgactccgctcttgaacgggccgcaagttggtattttaggg
atgcattcgatcaaactgcgtccggtagctattgatgaggagcggattgaaaaccggccg
atgatgtatgtcgctctgtcgtacgatcaccgcatcattgatggcaaagaagcagttggg
ttcttaaaaacagtgaaagacttgatcgaaaatccagaagatttattgcttgaaagttaa

DBGET integrated database retrieval system