KEGG   Geobacillus thermodenitrificans: GTNG_0886Help
Entry
GTNG_0886         CDS       T00496                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00020  Citrate cycle (TCA cycle)
gtn00310  Lysine degradation
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Module
gtn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gtn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTNG_0886
  Amino acid metabolism
   00310 Lysine degradation
    GTNG_0886
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GTNG_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ABO66264
UniProt: A4ILR0
Position
962218..963537
Genome map
AA seq 439 aa AA seqDB search
MMTNGMFEEGINVAEIKVPELAESITEGTIAQWLKKPGDYVEKGESVCELETDKVNVEIM
AEESGVLQQLLANEGDTVAVGQAIAIIGEGAASAPTAAPQAAQPTDETPTVPADRAEQQA
PQPVAVAQAPGQRPVASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAGSQ
AAPQPAPTAAPVSVPTQASAPSAESGKLVIREKMSRRRQTIAKRLLEVSQSTAMLTTFNE
IDMSAVMELRKRKKDKFLEEHDVRLGFMSFFVKATVAALKKYPYVNAEIQGDEILLKKYY
DIGVAVSTDEGLVVPVVRDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGG
VFGSLLSTPLLNGPQVGILGMHSIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVG
FLKTVKDLIENPEDLLLES
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaacggaatgtttgaggagggcatcaacgtggctgagatcaaagtcccagaa
ctagcagagtccatcaccgaaggtacgatcgctcaatggctgaaaaagccgggcgactat
gtggaaaaaggtgaatcggtttgtgagttagaaacagataaagtgaacgtcgaaattatg
gccgaagagtcgggagttttacagcaattgttggcgaacgaaggtgacacggtcgctgtc
ggccaagcgatcgccattatcggcgagggggcggcttcggcaccgactgctgctccgcag
gctgcgcagccaactgacgaaacaccaaccgtgccggctgaccgcgccgagcaacaagca
ccgcaaccggtcgctgtcgcccaagcaccgggccaacgtccagtcgcttcgccggccgct
cgaaaaatggcgcgtgagaaagggattgatttgacgcaagtgccgaccgttgatccgctt
ggacgcgtccgcaagcaagacgtggcttcatttgccgctcaaccagcagctggttcacaa
gcagcgccgcaaccggctccaacggctgcgccggtttctgtgccaacacaggcttctgcg
ccgtcagcggaaagcggcaagctggtcatccgtgaaaaaatgtcgcgccgccggcaaacg
atcgccaagcgattgcttgaagtttcgcaatcgactgcgatgctgacgacgttcaatgaa
atcgacatgtcagccgttatggaattgcgcaagcggaaaaaagacaagtttttagaagag
catgacgtccgccttggctttatgtcgtttttcgtcaaagcgacggtggcagcgctgaaa
aaatatccatacgtcaacgcggaaattcaaggcgatgaaattttgctgaaaaaatattac
gacatcggcgtggctgtttcgaccgatgaagggcttgttgtcccagttgtgcgtgactgt
gaccggaaaaacttcgctgaaattgagcgagacatcgctgaattagcggcgaaagcgcgc
agcaacaaactgtcgcttgccgatttgcaaggcggtacgtttacaatcaccaacggtggt
gtattcggctcgcttctttcgactccgctcttgaacgggccgcaagttggtattttaggg
atgcattcgatcaaactgcgtccggtagctattgatgaggagcggattgaaaaccggccg
atgatgtatgtcgctctgtcgtacgatcaccgcatcattgatggcaaagaagcagttggg
ttcttaaaaacagtgaaagacttgatcgaaaatccagaagatttattgcttgaaagttaa

DBGET integrated database retrieval system