KEGG   Geobacillus thermodenitrificans: GTNG_0886Help
Entry
GTNG_0886         CDS       T00496                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTNG_0886
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTNG_0886
  Amino acid metabolism
   00310 Lysine degradation
    GTNG_0886
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GTNG_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962218..963537
Genome map
AA seq 439 aa AA seqDB search
MMTNGMFEEGINVAEIKVPELAESITEGTIAQWLKKPGDYVEKGESVCELETDKVNVEIM
AEESGVLQQLLANEGDTVAVGQAIAIIGEGAASAPTAAPQAAQPTDETPTVPADRAEQQA
PQPVAVAQAPGQRPVASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAGSQ
AAPQPAPTAAPVSVPTQASAPSAESGKLVIREKMSRRRQTIAKRLLEVSQSTAMLTTFNE
IDMSAVMELRKRKKDKFLEEHDVRLGFMSFFVKATVAALKKYPYVNAEIQGDEILLKKYY
DIGVAVSTDEGLVVPVVRDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGG
VFGSLLSTPLLNGPQVGILGMHSIKLRPVAIDEERIENRPMMYVALSYDHRIIDGKEAVG
FLKTVKDLIENPEDLLLES
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaacggaatgtttgaggagggcatcaacgtggctgagatcaaagtcccagaa
ctagcagagtccatcaccgaaggtacgatcgctcaatggctgaaaaagccgggcgactat
gtggaaaaaggtgaatcggtttgtgagttagaaacagataaagtgaacgtcgaaattatg
gccgaagagtcgggagttttacagcaattgttggcgaacgaaggtgacacggtcgctgtc
ggccaagcgatcgccattatcggcgagggggcggcttcggcaccgactgctgctccgcag
gctgcgcagccaactgacgaaacaccaaccgtgccggctgaccgcgccgagcaacaagca
ccgcaaccggtcgctgtcgcccaagcaccgggccaacgtccagtcgcttcgccggccgct
cgaaaaatggcgcgtgagaaagggattgatttgacgcaagtgccgaccgttgatccgctt
ggacgcgtccgcaagcaagacgtggcttcatttgccgctcaaccagcagctggttcacaa
gcagcgccgcaaccggctccaacggctgcgccggtttctgtgccaacacaggcttctgcg
ccgtcagcggaaagcggcaagctggtcatccgtgaaaaaatgtcgcgccgccggcaaacg
atcgccaagcgattgcttgaagtttcgcaatcgactgcgatgctgacgacgttcaatgaa
atcgacatgtcagccgttatggaattgcgcaagcggaaaaaagacaagtttttagaagag
catgacgtccgccttggctttatgtcgtttttcgtcaaagcgacggtggcagcgctgaaa
aaatatccatacgtcaacgcggaaattcaaggcgatgaaattttgctgaaaaaatattac
gacatcggcgtggctgtttcgaccgatgaagggcttgttgtcccagttgtgcgtgactgt
gaccggaaaaacttcgctgaaattgagcgagacatcgctgaattagcggcgaaagcgcgc
agcaacaaactgtcgcttgccgatttgcaaggcggtacgtttacaatcaccaacggtggt
gtattcggctcgcttctttcgactccgctcttgaacgggccgcaagttggtattttaggg
atgcattcgatcaaactgcgtccggtagctattgatgaggagcggattgaaaaccggccg
atgatgtatgtcgctctgtcgtacgatcaccgcatcattgatggcaaagaagcagttggg
ttcttaaaaacagtgaaagacttgatcgaaaatccagaagatttattgcttgaaagttaa

DBGET integrated database retrieval system