KEGG   Geobacillus thermodenitrificans: GTNG_0980Help
Entry
GTNG_0980         CDS       T00496                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gtn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gtn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047075..1048544
Genome map
AA seq 489 aa AA seqDB search
MKLQTLLSRLPGFWVHRGGNPDIVALEMDSRHVTPGSLFFCVKGFTVDGHDFAEQAVERG
AVAIVAERPLSVNVPVVVVPDSRRAMAILADAFYGQPTHRLHLIGVTGTNGKTTTTHIIE
QVARKAGKKIGLIGTVGTKIGDRSYPAVNTTPESLVLQRTFKQMVDEGVEFVTMEVSSHA
LHQGRVHGCDYDVAVFTNLTQDHLDYHGTMEEYRNAKGLLFAQLGNRYDERRPKFAVLNH
DDPVSQYYKHMTAAPIITYGIKEKSDVMAEQIEMTPGGMAFQLCTPHGTMAIETKLVGLF
NVYNLLAATAACLASGFSLATIAEALANVSPVPGRFETVDEGQNFTVIVDYAHTPDSVEN
ALKTVRQFAKRNVYVVIGCGGDRDRTKRPLMAQAAVRYADVAVFTSDNPRSEDPRQILRD
MEAGVSAGDGTYVTIPDREEAIRYAIGQAQEGDVVLIAGKGHETYQIIGDDVIDFDDRAV
ARAAVKERR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaaacgctgctgtcacgcttgcccggcttttgggtgcatcgcgggggcaac
ccggatatcgttgcgctggagatggactcgcgccatgtcacgcctggttctctctttttt
tgtgtgaaaggatttaccgtggatggacacgattttgccgaacaggcggtggagcgcggg
gcggtggcgattgtcgccgagcgcccgctctcggtgaatgtgccggttgttgttgtgccg
gacagccgacgagcgatggcgattttagcggatgcgttttacggtcagccgactcaccgc
cttcatttaatcggagtgacgggcacaaacggtaaaacaacgacgactcatatcattgag
caggtggcgagaaaagccggcaagaaaatcggactcatcggcacggttgggacgaaaatc
ggcgaccgttcttacccggcagtgaatacgacaccggagtcacttgtcttgcagcgtacg
tttaaacaaatggttgacgaaggtgtggagtttgtaaccatggaagtgtcatcacacgcc
cttcaccaaggacgggtgcacggttgcgattacgacgtcgccgtgtttacgaacttgaca
caagaccacttagactatcatggaacaatggaagaatatcggaacgccaaagggctgctg
tttgcccaacttggcaaccgttacgacgagcggcggccaaaatttgccgttctcaatcat
gacgaccccgtttcgcaatattataaacatatgacagctgcaccgatcatcacatatggc
ataaaggaaaaaagtgatgtgatggcagagcaaatcgaaatgactcccggcggcatggca
tttcaactgtgcactccgcatgggaccatggcgatcgaaacgaagctggtcggcctgttt
aacgtctataacctcctcgctgccacagccgcttgccttgcgtccggcttttcgcttgcg
acgattgccgaggcgctcgctaatgtctcgccggtgccggggcggtttgaaacggtcgat
gaagggcaaaattttactgttattgtcgattatgctcatacgccggatagtgtggaaaat
gcactgaaaaccgtgcggcaatttgcaaagcgaaacgtgtatgttgtgatcggctgcggc
ggtgaccgcgaccgaacaaagcggccgctcatggcgcaagcggcggtgcgctatgcggat
gtcgctgtttttacctccgacaatccgcgctcggaagacccgaggcaaattttgcgcgat
atggaggccggcgttagtgctggggacgggacgtatgtgaccattcccgaccgggaagag
gcgatccggtatgccattgggcaggcgcaagaaggtgatgtcgtgttaattgccggcaaa
gggcatgaaacgtatcaaatcatcggcgacgatgtgatcgactttgacgatcgcgctgtc
gcccgagcggcggtgaaggagagaagatga

DBGET integrated database retrieval system