KEGG   Geobacillus thermodenitrificans: GTNG_1095Help
Entry
GTNG_1095         CDS       T00496                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GTNG_1095
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GTNG_1095
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GTNG_1095
Two-component system [BR:gtn02022]
 CheA family
  CheA-CheYBV
   GTNG_1095
Bacterial motility proteins [BR:gtn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GTNG_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157160..1158206
Genome map
AA seq 348 aa AA seqDB search
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGQEALEKIAVLHPDVVTLDVEMP
VMDGLETLRHIMEKKPLPVVMVSSTTKEGAENTVTAMQYGAVDFVAKPSGSLSLDLYKVR
DELVRKVLHASEANIRALTVRRSKVGPWRSLDKTAHVGKAIVAIGTSTGGPRALETVLTQ
LPPDLAAPVVIVQHMPKGFTKSLANRLDALSAITVKEAEDGEVLRNGTAYIAPGGVHLAV
REENGVLKAHFDASPPRAGHRPAVDVLFESLAAIHHCRKVVVIMTGMGADGTKGLKKLKE
SGDVEAIAEARETAVIYGMPRAAIETGVIDVITPLDGIAAAIVQSIGE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcaaggtgcttgttgtcgatgactcggcgtttatgcgcaaatggatcagc
gattttttgtccgaacacccgcgccttgaagtcattggaacggcccgcaatggtcaagag
gcgcttgagaaaatcgctgttcttcaccctgatgttgtgacgctcgacgtcgaaatgcca
gtgatggacggactggaaacattgcggcatatcatggagaagaagccgttgccggtcgtc
atggtatcaagcacgacgaaggaaggggcggaaaatacggtaaccgccatgcaatatggg
gccgttgattttgtggcgaaaccatctggttcgctttcgcttgatttatacaaagtgagg
gatgaactagtccgaaaagtgttgcatgcaagcgaagcgaacataagggcgctcaccgtc
cggcgctcgaaagtcggaccttggcgttcactcgacaaaacggcgcacgtcggaaaagcg
atcgtcgccatcggcacctcaaccggcggcccacgagccttagaaaccgtgctgacgcag
ctgccgcccgatttggccgctccagttgtcatcgtccagcatatgccgaaaggatttacg
aaatcgcttgccaaccggctggacgcactatccgccataactgtcaaagaggcagaagat
ggggaggtgctgcgaaatggcactgcttatatcgccccaggcggtgttcatcttgccgtc
agggaggaaaacggtgtgctgaaagcccattttgatgcgtcgccgccgcgcgccggccac
cgcccagccgttgacgtgttgttcgaatcacttgccgccattcaccactgccggaaagtg
gtggtaatcatgaccggaatgggagcagatgggacgaagggactgaaaaagttgaaagaa
agcggagacgtggaagcgatcgccgaagcgcgcgagacagcagtcatttatgggatgccg
agggcggcgatcgagaccggtgtcatcgatgtcattactccgcttgacggcattgccgcc
gccatcgtccaatcgatcggggaatga

DBGET integrated database retrieval system