KEGG   Geobacillus thermodenitrificans: GTNG_1216Help
Entry
GTNG_1216         CDS       T00496                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GTNG_1216 (glpK)
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GTNG_1216 (glpK)
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTNG_1216 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283820..1285319
Genome map
AA seq 499 aa AA seqDB search
MFMTDQYILAIDQGTTSSRAILFNRGGEIVHMAQKEFTQYFPQPGWVEHNANEIWGSVLA
VIASVLSEAQVKPEQVAAIGITNQRETTVVWEKESGNPIYNAIVWQSRQTADICDELKAK
GYDPLFREKTGLLIDAYFSGTKVKWILDHVDGARERAERGELLFGTIDTWLIWKLSGGRA
HVTDYSNASRTLMFNIHTLEWDDELLAILNVPKAMLPEVRPSSEVYAKTVPHHFFGVEVP
IAGAAGDQQAALFGQACFAEGMAKNTYGTGCFMLMNTGEKAVQSKHGLLTTIAWGIDGKV
EYALEGSIFVAGSAIQWLRDGLRMIKTAADSETYAEKVESTDGVYVVPAFVGLGTPYWDS
EVRGAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADAGLPLTTLRVDGGAVKNNLL
MQFQSDLLAVPVERPMISETTALGAAYLAGLAVGYWGSREDIAAQWQLEHRFEPQMTDDK
RTALYEGWKKAVRAAMMFK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgacagatcaatatattttagcgattgaccaaggcacaacaagctcgcgcgcc
attttgttcaaccgtggtggagaaattgttcatatggcgcaaaaagaatttacgcaatat
ttcccacagcccggctgggttgagcataatgcgaacgaaatttggggctcggtgcttgcg
gtcattgccagtgtcttgtctgaggcgcaagtgaagccggaacaagtggcggcgatcggc
attacgaaccagcgggaaacgaccgttgtctgggaaaaagagagcggcaatccgatttac
aacgccatcgtttggcaatcgcggcaaacggctgatatttgcgacgagttgaaagcgaaa
gggtatgatccgctgtttcgcgaaaaaacggggctgctcattgacgcttatttttcggga
acgaaagtgaaatggattttagatcatgtcgacggagcgcgtgaacgggcggagcgcggc
gagctgctgtttggcacgatcgacacgtggcttatttggaagctgtccggcggccgcgct
catgtgactgattactcgaatgcgtcgcgtacattgatgtttaacattcatacgcttgaa
tgggacgatgagttgcttgcaattttaaacgtgccaaaggcgatgctccctgaggtgcgg
ccgtcctcggaagtatatgcgaaaaccgttccgcatcatttcttcggcgtggaagtgccg
atcgctggggcggcgggtgaccagcaggcagccttgttcggacaggcgtgctttgctgaa
gggatggcgaagaatacatacggcaccggctgctttatgctcatgaacaccggagaaaaa
gcggtgcagtcaaaacacgggctgttgacaacaattgcttggggcatcgatggcaaagtc
gaatatgcgcttgaaggcagcatcttcgtcgccggttcggccattcaatggctgcgcgac
ggcttgcggatgatcaaaacggcggctgacagcgaaacgtacgccgaaaaagtcgagtca
acggacggggtgtacgttgtcccggcgttcgtcggtctcggcacgccgtattgggacagc
gaggtgcgtggagcggtgtttggcctcacgcgcggcacgacgaaagaacatttcatccgt
gcgacattggaatcgctcgcctaccagacaaaggacgtgctcgccgctatggaagcggat
gccggcttgccgctgacgacattgcgcgtcgacggaggagcggtgaaaaacaacttgctc
atgcagtttcaaagcgatttgctcgctgtgccggtcgagcggccgatgattagcgagacg
accgcgcttggagcggcgtacttagctgggctggcggtcggctattggggcagtcgtgaa
gatattgctgcccagtggcagcttgagcaccgctttgagccgcagatgactgacgataag
cgaacggcactctatgaaggctggaaaaaagcagtgcgggcggcgatgatgtttaaataa

DBGET integrated database retrieval system