KEGG   Geobacillus thermodenitrificans: GTNG_1289Help
Entry
GTNG_1289         CDS       T00496                                 

Definition
beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GTNG_1289
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GTNG_1289
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GTNG_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1369758..1371851
Genome map
AA seq 697 aa AA seqDB search
MSFYWKTAVFMTVITFFISWASPQVGAKEKVGVDLIIYQNIPEVDVTIDGNTVALRALKV
YPKGNFSEVTTGVQWKSSNRQVASVSRNGTVVFSGKSGKTFITVTDGVRKDRIGFTVKPV
SAAKKGGKSDIKVSVSKEKGSRYDVISRAVKGLTLEEKIGQMLMPDFRYFNGAPVTAMRP
EIKELIQKYHIGGIILFRENVVTTEQTARLVMDYQQAAEKFGLLISIDQEGGIVTRLQSG
TNMPGNMTLGATRSESLAYKVGHAIGEELYALGINMNLAPVLDVNNNPDNPVIGVRSFGE
NPELVAQLGTAYMKGLQDIGVAATAKHFPGHGDTAVDSHLGLPEVPHDRSRLETVEWYPF
QKAMEAGIDAVMTAHVTFPKIDDTKVISQKDGTEISLPATLSHKVLTELMRQEMGFQGVI
ITDAMNMKAISDHFGPVDAAVRAVQAGADIVLMPIGLEEVATGLKKAVENGEISQERIDQ
SVKRILTLKVKRGIFKQETPPNEQEVIDRALRVVGSEEHKQIEREAAAKSITLVKNEQVL
PLSPSKIDHLVVVGNTMIETLAEAVRAYVSNVTVIQGAAPLNEEQLQSVKKADAVIVGTY
TSNASERLPSNPQMKMVRQMIDNTDAPVIAIGIRNPYDMMSYPDVEAYLAQYSFQPASFQ
AVVDVIFGINMPTGRLPVTIPRYDGGILYEYGHGLSY
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtcattttattggaaaacagctgttttcatgactgtgatcacctttttcatttcgtgg
gcctcgccacaggttggagccaaagagaaagtgggagtcgatttgattatctaccagaat
atccctgaggttgacgtaaccatcgacgggaatactgtcgcattgcgggcattgaaagtt
tatccaaaaggaaatttttctgaagtgacaacaggggttcaatggaaatcatccaatcga
caagtcgcttctgtcagccgcaacggtaccgtagttttcagcgggaaaagtggaaaaacg
ttcatcaccgttaccgatggcgttcgcaaagatcgaatcggatttactgtaaaacccgtt
tctgcagcaaaaaaagggggaaaatcagacatcaaagtgtctgtttctaaggaaaaagga
agccgttatgacgtgatttcgcgagcggttaaagggttgacactagaagaaaaaatcggc
cagatgctaatgccggatttccgatattttaacggagcacctgtcacggcgatgcgtccg
gaaatcaaagagctcatacaaaaatatcatattggcggcattattttattccgagaaaac
gttgtaacgaccgagcagacagcacggcttgtgatggattatcaacaagcagcggaaaag
ttcggtttgctgatctccatcgatcaggaaggcggcattgtgacgaggttgcagtcaggg
acgaatatgccagggaatatgacgctcggagctacgcgttcggagtcactcgcttacaaa
gtaggacatgcgattggcgaagagttatacgcgttaggcataaatatgaatttagcacct
gttttggacgtaaacaacaatccggataatccggttatcggggttcgttcattcggtgaa
aatccagaattggtcgcccaactagggacagcatatatgaaagggctgcaagatatcggc
gttgccgctaccgccaagcattttcctggtcatggggatactgcggtcgactctcatctc
ggacttcccgaggtgccacacgaccgaagccgtcttgaaacggtggaatggtatccgttt
caaaaggcaatggaagctgggattgacgcggtgatgaccgcccatgtcacattcccgaaa
atcgatgatacgaaagtcatttcccaaaaagacgggacagaaatttcgcttcctgccaca
ttgtcacataaagtgcttacggaattaatgcgtcaagaaatgggatttcaaggcgtgatt
attacggatgctatgaacatgaaagccatcagcgatcatttcggaccggtcgatgcagca
gttagagcggtgcaagcgggtgcggatattgtgttgatgccgatcggattggaagaagtt
gctaccggtttgaagaaggcggtggaaaacggtgagatctcacaagagaggatcgatcaa
tccgtgaaacggattttgacgttgaaagtgaaacggggcatttttaagcaagagacgccg
ccgaatgaacaggaagtgatcgatcgcgcgttgcgtgttgtcggttcagaggagcataaa
caaatcgagcgcgaagcggcagccaaatcgatcacattggtgaaaaatgaacaagtattg
ccgctatcgccaagcaaaatcgatcatctcgtcgttgtcggcaatacgatgattgaaaca
ttggctgaagcggtgcgggcatatgtgtccaatgtgactgtgattcaaggtgcagctccg
ttaaacgaggagcagttacaaagcgtaaaaaaagccgatgccgttattgtcggcacttat
acgtcaaacgcctcagagcggctgccgtccaatccacaaatgaaaatggtgcgacaaatg
attgataatacggatgctcctgttattgctatcgggattcgcaacccgtatgatatgatg
tcctacccggacgttgaggcatatttggcccagtatagttttcaaccggcaagttttcag
gcggtggtagatgtgatttttggaatcaacatgccaaccggccggcttccggtaacgatt
ccacgttatgatggcggtatattgtacgaatatggtcatggccttagttactaa

DBGET integrated database retrieval system