KEGG   Geobacillus thermodenitrificans: GTNG_1384Help
Entry
GTNG_1384         CDS       T00496                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTNG_1384
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GTNG_1384
   00630 Glyoxylate and dicarboxylate metabolism
    GTNG_1384
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GTNG_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469491..1471674
Genome map
AA seq 727 aa AA seqDB search
MIEYVQAGTIQVAKVLYEFVNEELLPNSGLDQDKFWSDFAALIADLTPRNKELLARRDEI
QEKLNEWYKEHRGRFDFHEYKAFLTDIGYLEPEVEDFEITTDNVDEEIAVQAGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAISEEDGAERGSSYNPVRGAKVIAYGRQFLDEAVP
LVEHSHKDAVQYAIVDGKLVVTTEGGATTGLKEPEKLIGFQGEPQNPTAVLLKNNGLHIE
IQIDREHPVGKTDKAGIKDIVLEAAVTTIMDGEDSVAAVDAEDKVVVYRNLFGLIKGDLT
ATFEKNGKRLTRTLNPDREYKTPDGGELVLPGRSLMFVRNVGHLMTNNAILDANGEEVYE
GIIDAVVTSLIMKHSLIGNTRYLNSRKGSIYIVKPKMHGSAEVAFANELFDRVEDMLGLE
RNTIKIGVMDEERRTSLNLKNCIYEVRDRIVFINTGFLDRTGDEIHTSMEAGPMRRKNDM
KSSTWLAGYEKSNVAVGLAAGFRGRAQIGKGMWAMPDLMAEMLKQKGAQLKAGANTAWVP
SPTAATLHALHYHQVNVAAVQNELANDRNDYRDDILQIPVVDNPQWTADEIQEELDNNCQ
SILGYVVRWIDQGIGCSKVPDIHNIGLMEDRATLRISSQILANWLHHGICTKEQVLETFK
RMAKVVDEQNAGDPNYRPMAPNYDDSVAFQAACDLVFLGYEQPNGYTEPILHRRRQEAKA
KFAAVQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtatgtgcaagcggggacaattcaagtcgcgaaagtgttgtatgagtttgtc
aatgaggagctgttgccgaacagcggacttgaccaagacaagttttggagcgattttgcc
gcgctgatcgccgatttgacgccgcgcaataaagagttgcttgcgcgtcgcgacgagatt
caggagaaattgaatgagtggtataaagaacaccgcggccgctttgattttcatgaatat
aaagcgtttttaacggacatcggctatttggagccagaagtggaggattttgagattacg
actgacaatgtcgatgaagaaattgccgtgcaagcagggccgcagctcgtcgttccgctg
acgaacgcccgctacgcgttaaacgctgccaacgcccgttggggcagcttgtatgatgcg
ctgtatggcacggacgccattagtgaagaagacggcgccgagcgcggttcgtcgtacaac
ccggtgcgcggagcgaaagtcattgcatacgggcggcaatttttagatgaagcagtaccg
cttgtggaacactcccataaggatgctgtccaatacgccattgttgatgggaagcttgtc
gtgacgacagaaggaggggcgacgacagggctgaaagagccggaaaaacttatcggcttc
caaggcgagccgcaaaacccgacggcggtgttgctgaaaaacaacggccttcatattgaa
attcaaatcgaccgtgaacatccagtcggcaaaacagataaagccggcatcaaagacatc
gtcttagaagcggccgtgacgacgattatggacggcgaagattcggtcgcagctgtcgac
gcagaggacaaagtggtcgtgtatcgcaacttgttcgggttgattaaaggcgatttgacg
gcgacgtttgagaaaaacgggaaacggctgacgcgcaccttgaatccggatcgtgagtac
aaaacgccagatggcggggagcttgtgctgccgggtcgttcgctcatgttcgtgcgcaac
gtcggccatttgatgacaaacaacgctattttggatgcgaacggcgaagaagtgtatgaa
ggaatcatcgatgcggtagttacgagcttaatcatgaaacattcactcatcggcaacacg
cgctacttgaactcgcgcaaaggctcgatttacatcgtcaagccgaaaatgcacggatcg
gcagaagtggcatttgccaatgagctgtttgaccgtgtcgaggatatgctcggccttgag
cggaatacgattaaaattggtgttatggatgaagaacggcggacatcgctcaatttgaaa
aactgcatttacgaagtgcgcgaccgcatcgtcttcattaataccggcttcctcgaccgg
actggagatgagattcatacatcgatggaagcaggaccgatgcggcgcaaaaacgatatg
aagtcgtcgacatggctggccggctatgaaaaatcgaacgtggcggtcgggctcgcagcc
ggattccgcggccgggcacaaatcggtaaagggatgtgggcgatgccggacttgatggcg
gaaatgctgaaacaaaaaggtgcgcaattaaaagccggcgcgaacaccgcatgggtaccg
tctccgactgctgctacgctccatgcgctccattatcatcaggtgaacgttgctgccgta
caaaatgagctggccaatgatcggaatgattatcgcgacgacattttgcaaattccggtt
gtcgacaacccgcaatggacggcggacgaaattcaagaagagctcgacaacaactgccaa
agcattttaggttatgttgtccgttggattgaccaagggatcggctgctcgaaagtgccg
gacatccacaacatcggattgatggaagaccgggccacgctccgcatttcgagtcaaatt
ctcgccaactggcttcaccacggtatttgcacgaaagagcaagtgttggagacgttcaaa
cggatggcgaaagtcgtcgacgaacaaaacgccggcgatccgaactaccgcccgatggcg
ccaaactacgacgattcagtggcgttccaagcggcatgcgatctcgtgttcctcggctat
gaacagccaaatggttatacggagccgattttgcatcgtcgccgccaagaagcaaaagca
aaatttgctgccgttcaacagtaa

DBGET integrated database retrieval system