KEGG   Geobacillus thermodenitrificans: GTNG_1658Help
Entry
GTNG_1658         CDS       T00496                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTNG_1658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTNG_1658
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GTNG_1658
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GTNG_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750485..1751696)
Genome map
AA seq 403 aa AA seqDB search
MSFSYASHLYCSKCERTYDVDHVHQLCECGSPLLVAYDLEAMRQEVAREALKEREPSLWR
YHELLPVKHPKHIVSLGEGMTPLVRMARLGRNIGIDSLYMKDEGVIPTGTFKARGAAVGV
SKAKELGVEQLAMPTNGNAGAAWSLYASRAGIRATVVMPVDAPELTRKECAIAGAELYLV
NGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQLSWQLPDVILYPTGG
GVGLIGIYKAIKELQALGWVSGKMPRLVAVQAEHCAPIVKAWNEKKRESEFWPNSHTVAF
GINVPKAFGDFLVLEAVYETDGCAIAIDDEAILAQQQMVAKAEGAFICPEGAAAFAAARQ
LRESGWIRDGETVVVLNTGTGLKYADMVNVNPPVLELGEELIR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttagttacgcatcccatctctactgctcgaaatgcgaacgtacatatgatgtc
gatcacgtgcaccagctttgcgaatgcggttctccacttctagtcgcctatgatttggaa
gcgatgcgccaagaagtggcacgggaagcgctcaaggaacgtgaaccgagcttatggcgg
tatcatgagctattgccggtgaaacatcccaaacatatcgtctctttaggtgaagggatg
accccgcttgtacgaatggcgcgccttggccggaacatcgggattgattcactttatatg
aaagacgaaggggtcattccaacggggacgtttaaagctcgcggggcggcggtcggcgtt
tccaaagcgaaagaattgggggtcgaacagcttgctatgccgacaaacggcaacgcaggg
gcggcgtggtcgctttatgcttctcgagccggcattcgtgcgacggtggttatgccggtg
gatgcaccggagttgacgcgcaaggaatgtgccatcgcaggggcggaattatatttagtc
aacggcttgatcagcgatgctggacaaatcgtggcgaaagcgatccgtgaatacggttgg
tacgatgcttctacattgaaagaaccgtatcggattgaaggaaagaaaacgatgggactt
gagattgccgagcagctctcttggcagcttccggatgtcatcttgtatccgaccgggggc
ggcgttgggctcattggcatttacaaggcaatcaaagaactgcaggcgcttggttgggta
agcggcaagatgccgcggcttgtcgctgtgcaagccgagcattgcgcaccgattgtgaag
gcatggaacgagaaaaagcgtgagtcggaattttggccgaactctcatacggtggcgttt
ggcattaacgtgccaaaagcgtttggcgactttcttgtgcttgaggcggtgtatgagacg
gatggctgtgcgattgctatcgacgatgaggcgattttggcacaacagcagatggtggca
aaagcggaaggggcgttcatttgcccggaaggagcggcggcgtttgcggcggctcgccag
ctgcgcgaaagcggttggattcgtgacggggagaccgtcgttgtgctaaatactggaacc
ggattgaaatacgctgatatggtcaatgtcaatccgccggtactcgagctgggggaggag
ctgattagataa

DBGET integrated database retrieval system