KEGG   Geobacillus thermodenitrificans: GTNG_1678Help
Entry
GTNG_1678         CDS       T00496                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00480  Glutathione metabolism
gtn00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GTNG_1678
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GTNG_1678
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GTNG_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABO67042
UniProt: A4INY8
Position
complement(1768350..1768718)
Genome map
AA seq 122 aa AA seqDB search
MTPQYQELQELYDEYRDRGFVVLGFPCNQFGGQEPGTEEEIEQFCQLNYGVTFPMFAKVD
VNGDNAHPLFQYLKEQAPGALGTKAIKWNFTKFLVDRDGRVVARFAPQTKPSELKKEIEK
LL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgacaccgcaatatcaagaattgcaggagttgtatgacgaatatcgtgaccgcgggttt
gtcgtgctggggtttccgtgcaatcaattcggtggccaagaaccgggaacggaagaggaa
atcgagcagttttgccagttgaattacggtgtaacgtttccgatgtttgcaaaggtggat
gttaatggcgacaacgcccatccactgtttcaatacttgaaagaacaagcaccaggggca
cttggcacgaaggcgatcaaatggaattttactaagtttttggttgaccgcgatggtcga
gttgttgcccgcttcgctccgcaaacgaagccgagcgagttgaaaaaggaaattgaaaaa
ttgttgtag

DBGET integrated database retrieval system