KEGG   Geobacillus thermodenitrificans: GTNG_1717Help
Entry
GTNG_1717         CDS       T00496                                 

Gene name
porA
Definition
pyruvate synthase subunit PorA
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:gtn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gtn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gtn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gtn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gtn00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gtn00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:gtn00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1813685..1815952)
Genome map
AA seq 755 aa AA seqDB search
MANQAVQEMTFASGNEMAALAASQINYHIMGYFPITPSTEIAQLLDQMKGRGEHETMLIP
ADGEHGSAGICYGASLMGARVLNATSANGLMYMLEQLPVQSGTRFPMVLNLVTRSVSGPL
DIHGDHSDLYFTLNTGWVVLLARTPQAVYDMNVMALRIAEHEDVRLPVIIAYDGFFTSHQ
KRKVHYFRDRETVQAFIGPRKEGFPTAADPKRPVTIGAHMGGDDLINNHYQQSVALYRAG
DVFRQVAAEYEKWSGRRYEPLDLYRMEDAEVALFLLNSAAETAKDVADRLRKQGIKAGVI
SPNIIRPFPAEEIRQALKHVKALLIGERADSYGAHGANMTHEVKAALQEDRDNQTIVLSR
VYGLGGKDFYAEDAEALFRMAIDAMEKGKAEKTFDYFGHVPGRLEQQPKRLLEPIHGDAF
RSGLIHVTVDDKTKRLNVKIPPLRALTAKPKRLAPGHGACPGCGIFPGLELFFKGIEGDI
VVLFQTGCAYVVSAAYPYSSHKQTMVHNLFQNGAATLSGMVEAFFELKRRGELNVSDDVT
FVMVTGDGGMDIGMGSAIGTALRNHKLIIIEYDNEGYMNTGAQMSYSTPMGHMTTTTGVG
KGQRGKSFHHKDTPQIMAATNIPYVFTGTEAFPQDLVKKAAKAQWYAQHEGTVYGKLLIT
CPLNWKSEERYGETILQAAVNSCFFPLYEVERGKTTITYDPEAKGRRIPLSEWLKYMGKT
KHLLREENKDLLRELEEEVERRWTILKAKHEHPYL
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccaagcagtacaagagatgacgtttgcctccggcaatgaaatggcggcgtta
gcggcgagtcaaattaactatcacattatgggttacttcccgatcacgccgtcaacggaa
atcgcccagctgcttgatcaaatgaaagggcggggcgaacatgaaacgatgctcattcca
gcggatggtgagcacggttcagccgggatttgctacggcgcgtcgctcatgggggcgcgc
gtgctgaacgccacgagtgccaacgggctgatgtacatgcttgaacaactgccagtgcaa
tcaggcacccgctttccgatggtattgaatctcgtcacccgctcggtcagcggtccgctc
gatattcacggcgaccattccgatttgtattttacgctcaacaccggctgggttgtgctg
ctagcccgcacgccgcaagccgtttacgatatgaacgtcatggcgctcagaatcgccgaa
catgaggacgtccgcctgccggtcatcatcgcgtatgacgggtttttcacctcacatcaa
aaacggaaagtgcattatttccgcgatcgtgaaacggtgcaggcgttcatcggtccgcgc
aaagaagggttcccgacagcagccgatccgaaacgccctgtgacgatcggagcacatatg
ggcggcgatgatttgatcaacaaccattatcaacagtctgtcgccttgtaccgggctggc
gacgtattccggcaagtggccgcggaatatgaaaaatggtcggggcgtcgctatgagccg
ctcgatttataccggatggaagatgccgaagtggcgctgtttttgctcaactcggcggca
gagacggcgaaagacgtagccgaccgcctgcgaaaacaagggataaaagcgggcgtcatc
agtccgaacattattcgcccgttcccggccgaggagatccgccaagcgctaaaacatgtg
aaagcactgttgatcggtgagcgggccgattcgtacggggcgcacggggcgaatatgacg
catgaagtgaaagcggcactgcaggaagaccgcgataatcagacgatcgtattaagccgt
gtttacggccttggcggcaaagatttttacgccgaagacgctgaagcattgttccggatg
gccattgatgcgatggaaaaaggaaaagcggaaaaaacgtttgactatttcggccacgtg
cctggacgtcttgagcagcaaccgaaacggctgcttgaaccgatccatggcgatgcgttc
cgcagcggactcatccacgtgacggtcgatgacaaaacgaaacggctaaacgtcaaaatt
ccgccgctgcgggcgctgaccgccaagccgaagcgtctcgccccagggcatggggcatgc
ccaggatgcggcattttcccggggctcgagctgtttttcaaaggaattgaaggcgatatc
gtcgtcttgttccaaaccggatgcgcgtacgtcgtttcagccgcgtatccgtacagctcg
cataaacaaacgatggtgcacaatttgttccaaaacggggcggcaacgctctccggcatg
gttgaagcgttcttcgaactgaagcggcgcggcgagcttaatgtctcggatgatgtcacg
tttgtcatggtcaccggcgacggcgggatggacatcggcatggggtccgccatcgggacg
gcgctacgcaaccataagctgatcatcattgaatatgataacgaaggttatatgaacacc
ggggcgcaaatgtcgtactcgaccccgatgggccatatgaccacaacaaccggggttgga
aaaggacaacgcggaaaatcgttccatcataaagatacgccgcaaattatggcagcaacg
aacatcccgtacgttttcaccgggacagaagcgtttccgcaagatttggtgaaaaaagcg
gcgaaagcgcaatggtacgcgcagcatgaaggaacggtgtacggcaagctgctcattact
tgtccgctcaactggaaatcggaggagcggtacggggaaaccattttgcaggcagcggtg
aattcatgctttttcccgctgtatgaagtggagcgggggaaaacgacgattacgtacgat
ccagaagcaaaaggacgccgcatcccgttaagtgaatggctaaaatatatgggaaaaacg
aagcatttgcttcgggaagaaaacaaagatttgctgcgcgagttggaggaggaagtggaa
cggagatggacgattttaaaagcgaagcatgaacatccgtatctataa

DBGET integrated database retrieval system