KEGG   Geobacillus thermodenitrificans: GTNG_1719Help
Entry
GTNG_1719         CDS       T00496                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GTNG_1719 (hemD)
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GTNG_1719 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1817171..1817965)
Genome map
AA seq 264 aa AA seqDB search
MRGKRVALCASRKLDEMTTLIEKQGGTAVIRPAQGTVFLKGSELSEEMRAIIMMRPDWIV
FTTGIGVEALWKTAEREGIAVEWKRVIENADIAARGYKTVAALKNIGVIPTAVSEDGTTK
GLISALNAYDFAGKSVVAQLYGDTAPVLKQFFLTRGASYTELFPYRHVAPDHEMLEMLYN
EVVGREIDAVCFTSAIQVRFFFSFAREKQDITPLLEAFCTDVVACAVGKVTKEALEEEGV
SRVITPEHERMGAMIVTLARYFQQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcaaacgggtcgccttatgcgcttcgcgcaagttagacgaaatgacaacactc
attgaaaagcaaggaggaacggccgtcatccgcccggcgcaagggacggtttttttaaaa
ggaagtgaactcagtgaggaaatgcgcgcgatcattatgatgcggccggactggatagtg
tttacaacgggcattggggttgaagcgctctggaaaacggctgaaagggaagggatcgcg
gttgagtggaagcgcgtgatcgagaatgctgatatcgctgcgcgcggctataaaacggtg
gcggcattgaaaaacatcggcgttatcccaacagcggtgagcgaagacgggacgacgaag
ggattgatttccgcccttaacgcgtatgactttgccggcaagagcgtcgtcgcgcagcta
tacggtgatacggcgccagtcttgaagcaatttttccttacgcgcggtgcgtcttacaca
gagctattcccgtatcggcatgtcgccccagatcacgagatgctggagatgctatacaac
gaagtcgtcgggcgcgaaattgatgcggtctgttttacatcggcgatacaagtccgcttt
ttcttttcgtttgcccgggagaaacaagatatcactccgctgcttgaggcgttctgcacc
gatgtcgtcgcctgtgctgtcgggaaagtgacgaaagaagcgctggaagaggaaggagtc
agccgcgtcatcacccctgaacatgagcggatgggagcgatgatcgtgacgcttgcccgt
tattttcaacaataa

DBGET integrated database retrieval system