KEGG   Geobacillus thermodenitrificans: GTNG_1734Help
Entry
GTNG_1734         CDS       T00496                                 

Gene name
nosZ
Definition
nitrous oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:gtn00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1833227..1835095)
Genome map
AA seq 622 aa AA seqDB search
MKKKVISALSGLAVGVLASTVFFGNFSTPDTVSNASAKTDAEKVYVPFGEKDEYYLFASG
GHSGQMFIYGVPSMRRIRTVPVFSPDSATGYGWDAHSKKMLGGYTWGDLHHPAFSETNGE
YDGKYMFATDVANSRAAVMDLKTFTVKDIIEVPNTSGPHCAAFVTENTEYLFLPTRFSVP
LGHQYASLDEYSEKYRGVMSAVTFNEKAQKLHIAYQVALPPWSYDLSDAGKKISKDWAVL
TTYNTEEATTNLEINASQEDRDFIVLFNWKELENMVKEGKYDNVGGQKMIFPEKHKGGIY
LVPVAKSPHGVDVTPDGKYFIASGKLAPLLTVFSFEKAFQAIEKKEFAGERNGIPILKYE
SVMEREVNPENALGPLHTQFDDKGMAYTTMFISSEVVKWNPETGEVLDRVPVQYSPGHAV
AAEGDTVSPDGKYLVSLNKLAKDSYLSVGPSHPESMQLIDISGEKMKVIQSSPVDPEPHY
GQMIKADKIKTVEVYPKDENHPNAVYNQKDARIVRKGNEVHVYGIAMRSKFIFDANAKRP
DVIEVNEGDKVVVHLTNLDFDEDITHGFAINQYNLNMEIQPGQTNTIEFTADKPGTYPLY
CTNFCSALHQEMTGYLLVKPKQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaaaagtgatttccgcgttgtcggggttggcggttggggtgctggcgtcgact
gtctttttcgggaatttttctactcctgacaccgtttccaacgcatcggccaaaaccgat
gctgaaaaagtgtacgttccgtttggcgaaaaagatgaatactacttgttcgcttctggc
ggccattcggggcaaatgtttatttatggggtgccgtcgatgcgacgcattcgcactgtc
cctgttttttcgcctgattcggcgaccggctatgggtgggatgcccactcaaaaaaaatg
cttggcggctacacgtggggagatttgcatcacccggctttctcggaaacaaacggagaa
tatgacggcaagtatatgtttgccactgatgtggcgaacagccgggcggcggtaatggat
ttaaaaacgtttacagtcaaagacattatcgaagtccccaacacgagcggtccgcactgt
gccgcgtttgtgactgagaataccgagtacttatttttaccgacccggttttcggttccg
cttggccatcagtacgcctcgcttgatgagtatagcgaaaaataccgtggcgtcatgagt
gcggtcacgttcaatgaaaaagcgcaaaagctgcacatcgcctatcaagttgcgctgccc
ccgtggtcgtacgatttgtccgatgccggaaaaaaaatatcaaaagattgggccgtgctg
acaacgtacaataccgaagaagcgacaacaaacttagaaattaacgcatctcaagaagac
cgcgattttatcgtgttgttcaactggaaagagcttgagaacatggtgaaggaaggaaaa
tatgacaacgtcggcggccaaaaaatgatcttcccggaaaagcataaaggtggcatttat
ttggtaccggtcgccaaatcgccgcatggcgtcgatgtcactccagacggaaaatatttt
attgcttctgggaagctcgctccgctgttgacggtgttttcgtttgaaaaggcgtttcaa
gcgattgaaaagaaagagtttgctggtgagcggaacggcatcccgattttgaaatatgaa
tcggtgatggagcgggaagtcaatccggaaaacgcgcttgggccgttgcatacgcagttt
gacgacaaaggcatggcgtatacgacgatgtttatttcgtctgaagtcgtgaaatggaat
ccggaaactggggaagtgcttgaccgcgtcccggttcaatattcgccggggcatgccgtc
gcggctgaaggggatacggtgtctccggacggcaaatacttagtgtcgctcaacaagttg
gcaaaagacagctatttatcggttgggccgtcccatccggaatcgatgcagctcattgac
attagtggtgagaaaatgaaagtgattcaatcctcgccggtcgatccggaaccgcactat
ggacaaatgattaaggccgataaaattaaaacggttgaagtgtatccgaaagatgaaaac
catccgaatgcggtttacaaccaaaaagatgcccgcattgtccgaaaaggaaatgaagtg
cacgtctacggcatcgcgatgcgttcgaagtttatttttgacgccaacgcgaaacggccg
gatgtcattgaagtgaatgaaggggataaagtcgtcgtccacctgacgaacttagacttt
gatgaagacattacccatggttttgccatcaatcagtataacttgaatatggaaatccag
ccagggcaaacgaatacgattgagtttaccgctgataagccaggaacatatccgttgtat
tgcacgaacttctgttcggcgctgcatcaagaaatgaccggatatttgttggtgaagccg
aaacaatga

DBGET integrated database retrieval system