KEGG   Geobacillus thermodenitrificans: GTNG_1734Help
Entry
GTNG_1734         CDS       T00496                                 

Gene name
nosZ
Definition
(GenBank) Nitrous oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00910  Nitrogen metabolism
gtn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GTNG_1734 (nosZ)
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     GTNG_1734 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 Cu-oxidase_2 PPC Copper-bind
Motif
Other DBs
NCBI-ProteinID: ABO67098
UniProt: A4IP44
Position
complement(1833227..1835095)
Genome map
AA seq 622 aa AA seqDB search
MKKKVISALSGLAVGVLASTVFFGNFSTPDTVSNASAKTDAEKVYVPFGEKDEYYLFASG
GHSGQMFIYGVPSMRRIRTVPVFSPDSATGYGWDAHSKKMLGGYTWGDLHHPAFSETNGE
YDGKYMFATDVANSRAAVMDLKTFTVKDIIEVPNTSGPHCAAFVTENTEYLFLPTRFSVP
LGHQYASLDEYSEKYRGVMSAVTFNEKAQKLHIAYQVALPPWSYDLSDAGKKISKDWAVL
TTYNTEEATTNLEINASQEDRDFIVLFNWKELENMVKEGKYDNVGGQKMIFPEKHKGGIY
LVPVAKSPHGVDVTPDGKYFIASGKLAPLLTVFSFEKAFQAIEKKEFAGERNGIPILKYE
SVMEREVNPENALGPLHTQFDDKGMAYTTMFISSEVVKWNPETGEVLDRVPVQYSPGHAV
AAEGDTVSPDGKYLVSLNKLAKDSYLSVGPSHPESMQLIDISGEKMKVIQSSPVDPEPHY
GQMIKADKIKTVEVYPKDENHPNAVYNQKDARIVRKGNEVHVYGIAMRSKFIFDANAKRP
DVIEVNEGDKVVVHLTNLDFDEDITHGFAINQYNLNMEIQPGQTNTIEFTADKPGTYPLY
CTNFCSALHQEMTGYLLVKPKQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaaaagtgatttccgcgttgtcggggttggcggttggggtgctggcgtcgact
gtctttttcgggaatttttctactcctgacaccgtttccaacgcatcggccaaaaccgat
gctgaaaaagtgtacgttccgtttggcgaaaaagatgaatactacttgttcgcttctggc
ggccattcggggcaaatgtttatttatggggtgccgtcgatgcgacgcattcgcactgtc
cctgttttttcgcctgattcggcgaccggctatgggtgggatgcccactcaaaaaaaatg
cttggcggctacacgtggggagatttgcatcacccggctttctcggaaacaaacggagaa
tatgacggcaagtatatgtttgccactgatgtggcgaacagccgggcggcggtaatggat
ttaaaaacgtttacagtcaaagacattatcgaagtccccaacacgagcggtccgcactgt
gccgcgtttgtgactgagaataccgagtacttatttttaccgacccggttttcggttccg
cttggccatcagtacgcctcgcttgatgagtatagcgaaaaataccgtggcgtcatgagt
gcggtcacgttcaatgaaaaagcgcaaaagctgcacatcgcctatcaagttgcgctgccc
ccgtggtcgtacgatttgtccgatgccggaaaaaaaatatcaaaagattgggccgtgctg
acaacgtacaataccgaagaagcgacaacaaacttagaaattaacgcatctcaagaagac
cgcgattttatcgtgttgttcaactggaaagagcttgagaacatggtgaaggaaggaaaa
tatgacaacgtcggcggccaaaaaatgatcttcccggaaaagcataaaggtggcatttat
ttggtaccggtcgccaaatcgccgcatggcgtcgatgtcactccagacggaaaatatttt
attgcttctgggaagctcgctccgctgttgacggtgttttcgtttgaaaaggcgtttcaa
gcgattgaaaagaaagagtttgctggtgagcggaacggcatcccgattttgaaatatgaa
tcggtgatggagcgggaagtcaatccggaaaacgcgcttgggccgttgcatacgcagttt
gacgacaaaggcatggcgtatacgacgatgtttatttcgtctgaagtcgtgaaatggaat
ccggaaactggggaagtgcttgaccgcgtcccggttcaatattcgccggggcatgccgtc
gcggctgaaggggatacggtgtctccggacggcaaatacttagtgtcgctcaacaagttg
gcaaaagacagctatttatcggttgggccgtcccatccggaatcgatgcagctcattgac
attagtggtgagaaaatgaaagtgattcaatcctcgccggtcgatccggaaccgcactat
ggacaaatgattaaggccgataaaattaaaacggttgaagtgtatccgaaagatgaaaac
catccgaatgcggtttacaaccaaaaagatgcccgcattgtccgaaaaggaaatgaagtg
cacgtctacggcatcgcgatgcgttcgaagtttatttttgacgccaacgcgaaacggccg
gatgtcattgaagtgaatgaaggggataaagtcgtcgtccacctgacgaacttagacttt
gatgaagacattacccatggttttgccatcaatcagtataacttgaatatggaaatccag
ccagggcaaacgaatacgattgagtttaccgctgataagccaggaacatatccgttgtat
tgcacgaacttctgttcggcgctgcatcaagaaatgaccggatatttgttggtgaagccg
aaacaatga

DBGET integrated database retrieval system