KEGG   Geobacillus thermodenitrificans: GTNG_1754Help
Entry
GTNG_1754         CDS       T00496                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K19954  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
gtn  Geobacillus thermodenitrificans
Brite
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     GTNG_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1852842..1854029)
Genome map
AA seq 395 aa AA seqDB search
MSVARIVFPPLSHVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGY
SVHVYTDVVPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADY
LNLTGTRTLEKKGLPKILIPTTSGTGSEVTNISVLSLETTKDVVTHDYLLADVAIVDPQL
TVSVPPRVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQA
RIDMANGSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTKR
MADIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAVQ
QKRLLARSPLPLLEADIRAIYEAAFAGTIVEPHKA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagcccgcattgtctttccgccgctcagccatgtcggctggggagcgcttgac
cagttagttcctgaagtgaagcggttgggagcaaaacatattttggtgattaccgacccg
atgcttgtgaagatcggcctagtcgatcaagtgacgtccccgctccgtcaagaagggtat
agcgtgcatgtgtatacggatgttgtgccagagccgccgcttgagacaggggaaaaggca
gtggcgtttgcccgcgacggaaagtttgaccttgtcatcggtgttggtggtggcagcgcg
ctggatttggcgaaactggcggctgttttggcggtgcatgatggctcggtcgctgactat
ttaaatttgacaggaacgcgaacacttgagaaaaaagggttgccgaaaattttgattccc
acgacatcgggcaccgggtcggaagtgacaaacatctctgtcttgtctttggaaacgacg
aaagatgtcgtgacgcacgattacttattggccgacgtcgcgatcgttgatccgcagctg
accgtttccgttccaccgcgggtaacggccgcaacgggaattgatgcactcacccatgca
gttgaggcgtatgtgtcggtcaatgcgagcccaacatcggatggattggccgttgccgct
attcggctgatttcacgctcactgcgcaaagcggtggccaacggttcggacaaacaggcg
cgcattgatatggcgaacggcagttatttggccggcttggcatttttcaacgccggggta
gccggtgtgcatgcgctcgcttatccgctcggtggtcagtttcatatcgctcatggtgaa
tcgaatgctgtgctgttgccgtatgtgatgggctacatccgtcaaagctgtacgaagaga
atggccgatattttcaacgcgcttggcggcaactcaagttttttgtccgaagtggaagcg
tcttatcggtgcgtcgaggaactagaacggttcgtcgccgatgtcggcattccgaaaaca
ttggggggatttggcatccccgaaagcgcgctagaaagcttgacgaaagatgctgtccaa
cagaaacgtttgcttgcccgcagtccgttgccgctgttggaagccgacatccgtgcgatt
tacgaagccgcgtttgccgggacgatcgtagagccgcacaaggcgtaa

DBGET integrated database retrieval system