KEGG   Geobacillus thermodenitrificans: GTNG_1754Help
Entry
GTNG_1754         CDS       T00496                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GTNG_1754
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_1754
  Lipid metabolism
   00071 Fatty acid degradation
    GTNG_1754
  Amino acid metabolism
   00350 Tyrosine metabolism
    GTNG_1754
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GTNG_1754
   00626 Naphthalene degradation
    GTNG_1754
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GTNG_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1852842..1854029)
Genome map
AA seq 395 aa AA seqDB search
MSVARIVFPPLSHVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGY
SVHVYTDVVPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADY
LNLTGTRTLEKKGLPKILIPTTSGTGSEVTNISVLSLETTKDVVTHDYLLADVAIVDPQL
TVSVPPRVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQA
RIDMANGSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTKR
MADIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAVQ
QKRLLARSPLPLLEADIRAIYEAAFAGTIVEPHKA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagcccgcattgtctttccgccgctcagccatgtcggctggggagcgcttgac
cagttagttcctgaagtgaagcggttgggagcaaaacatattttggtgattaccgacccg
atgcttgtgaagatcggcctagtcgatcaagtgacgtccccgctccgtcaagaagggtat
agcgtgcatgtgtatacggatgttgtgccagagccgccgcttgagacaggggaaaaggca
gtggcgtttgcccgcgacggaaagtttgaccttgtcatcggtgttggtggtggcagcgcg
ctggatttggcgaaactggcggctgttttggcggtgcatgatggctcggtcgctgactat
ttaaatttgacaggaacgcgaacacttgagaaaaaagggttgccgaaaattttgattccc
acgacatcgggcaccgggtcggaagtgacaaacatctctgtcttgtctttggaaacgacg
aaagatgtcgtgacgcacgattacttattggccgacgtcgcgatcgttgatccgcagctg
accgtttccgttccaccgcgggtaacggccgcaacgggaattgatgcactcacccatgca
gttgaggcgtatgtgtcggtcaatgcgagcccaacatcggatggattggccgttgccgct
attcggctgatttcacgctcactgcgcaaagcggtggccaacggttcggacaaacaggcg
cgcattgatatggcgaacggcagttatttggccggcttggcatttttcaacgccggggta
gccggtgtgcatgcgctcgcttatccgctcggtggtcagtttcatatcgctcatggtgaa
tcgaatgctgtgctgttgccgtatgtgatgggctacatccgtcaaagctgtacgaagaga
atggccgatattttcaacgcgcttggcggcaactcaagttttttgtccgaagtggaagcg
tcttatcggtgcgtcgaggaactagaacggttcgtcgccgatgtcggcattccgaaaaca
ttggggggatttggcatccccgaaagcgcgctagaaagcttgacgaaagatgctgtccaa
cagaaacgtttgcttgcccgcagtccgttgccgctgttggaagccgacatccgtgcgatt
tacgaagccgcgtttgccgggacgatcgtagagccgcacaaggcgtaa

DBGET integrated database retrieval system