KEGG   Geobacillus thermodenitrificans: GTNG_1761Help
Entry
GTNG_1761         CDS       T00496                                 

Gene name
xynA
Definition
xylanase T-6
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gtn  Geobacillus thermodenitrificans
Brite
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     GTNG_1761 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1862421..1863644
Genome map
AA seq 407 aa AA seqDB search
MLKRSRKAIIVGFSFMLLLPLGMTNALAKTEQSYAKKPQISALHAPQLDQRYKDSFTIGA
AVEPYQLLNEKDAQMLKRHFNSIVAENVMKPINIQPEEGKFNFAEADQIVRFAKKHHMDI
RFHTLVWHSQVPQWFFLDKEGQPMVNETDPVKREQNKQLLLKRIETHIKTIVERYKDDIK
YWDVVNEVVGDDGELRDSPWYQIAGIDYIKVAFQTARKYGGNKIKLYINDYNTEVEPKRS
ALYNLVKQLKEEGIPIDGIGHQSHIQIDWPSEEEIEKTIIMFADLGLDNQITELDVSMYG
WPPRAYLSYDAIPEQKFLDQADRYDRLFKLYEKLSDKISNVTFWGIADNHTWLDSRADVY
YDTDGNVIVDPKAPYTRVEKGNGKDAPFVFDPEYNVKPAYWAIIDHK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaagatcgcgaaaagcgataatagttggattctcatttatgctgttgctccct
ttagggatgacgaatgcattggcaaaaactgaacaatcatacgctaaaaagcctcaaatc
agcgcattgcatgccccacaattggaccagcgctacaaagattcattcactattggtgcg
gctgttgaaccttatcagctactaaacgagaaagacgcacaaatgctaaaacgccatttt
aacagcattgtcgctgagaacgttatgaagccgattaatattcaaccggaagaaggaaaa
ttcaattttgctgaggcggatcaaatcgttcggtttgctaaaaaacaccatatggatatc
cgtttccacacgctcgtttggcatagccaagtacctcaatggttctttcttgacaaggaa
ggccaaccaatggtcaatgaaacggaccctgtgaaacgcgaacaaaataaacagctgtta
ttaaaacggatcgaaacccatattaaaacgattgtcgagcggtataaagatgacatcaaa
tattgggacgttgtaaatgaggtagtcggggatgatggagaattgcgcgattccccatgg
tatcaaatcgctggcatcgattatattaaggtagcgttccaaacagcgagaaaatatggc
ggcaacaagattaaactttacattaatgattacaatacggaagttgaaccaaagcgaagc
gctctttataacttggtgaaacaattaaaagaagagggcattcccattgatggtattggc
catcagtcccacatccaaattgactggccttctgaagaggaaatcgaaaaaacgattatc
atgtttgccgatctagggttagacaaccaaattactgagctggatgtgagcatgtacggc
tggccgccgcgggcttacctgtcgtatgacgccattccggagcaaaagtttttggaccaa
gcggatcgctatgatcgattgtttaagctgtatgaaaaactcagcgataaaatcagtaac
gtcaccttctggggcatcgccgacaaccatacgtggctcgacagtcgagcggatgtttac
tatgatactgatgggaatgtgattgtagacccgaaagccccatatacgagagtggaaaaa
gggaatggaaaagatgcgccatttgtgttcgaccccgaatacaacgtaaaacctgcgtat
tgggctattatcgatcataagtga

DBGET integrated database retrieval system