KEGG   Geobacillus thermodenitrificans: GTNG_1774Help
Entry
GTNG_1774         CDS       T00496                                 

Gene name
xynA2
Definition
Intra-cellular xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gtn  Geobacillus thermodenitrificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1878226..1879227)
Genome map
AA seq 333 aa AA seqDB search
MSVSQSLPSLREVFANDFRIGAAVNPVTIESQKQLLISHVNSLTAENHMKFEHLQPEEGR
FTFDIADRIVDFARSHHMAVRGHTLVWHNQTPDWVFQDGQGHFISRDVLLERMKSHISAV
VRRYKGKVYCWDVVNEAVADEGSEWLRSSKWRQIIGDDFIEQAFLCAHEADPDALLFYND
YNECFPKKREKIYTLVKSLRDKGIPIHGIGMQAHWSLTRPSLDEIRAAIERYASLDVVLH
ITELDVSMFEFHDHRKDLAAPTNEMIERQAERYEQIFTLFKEYRDVIESVTFWGMADDYT
WLDHFPVQGRKNWPFLFDEQHEPKSAFWRVASI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgagtcaatcgctcccctccctccgtgaagtatttgcgaatgactttcgcatt
ggagcggcagttaatccggtgaccattgaatcacaaaaacagctgttgattagccacgtc
aacagccttacagccgaaaaccatatgaagttcgaacaccttcagccggaagaagggcgg
ttcacgtttgacatcgccgatcgaatcgtcgatttcgctcgttcccatcacatggcggtt
cgcgggcatacgctcgtatggcataaccaaacgccggattgggtgtttcaggatggtcaa
ggtcatttcatcagcagggatgtgttgcttgagcggatgaagtcccacatttctgcagtt
gtacggcggtacaaggggaaagtgtattgctgggatgtggtcaacgaagcggtggctgac
gaggggagcgaatggttgcgttcatcgaagtggcgccaaatcattggggacgattttatt
gaacaggcgtttctctgtgctcatgaagccgacccagacgcgttgttgttttacaatgat
tataatgaatgttttccgaaaaaacgcgagaagatctatacactagttaaatctttgcga
gacaaagggattcccattcacggcatcggtatgcaggcgcattggagcctgacgcgcccg
tcattggacgaaattcgagcagccattgaacgatatgcgtctctcgatgtggttcttcac
attacggagcttgatgtatctatgtttgaatttcacgaccatcgcaaggacttagctgcc
cctacaaacgaaatgatcgaacgacaggcagagcggtacgaacaaattttcactctattc
aaggagtatcgtgacgtaattgaaagtgtaacattttggggaatggccgatgactatacg
tggctcgatcactttccggtgcaagggagaaaaaactggccatttttgtttgatgaacaa
cacgaaccgaagtcagctttttggagagtggcgagtatctaa

DBGET integrated database retrieval system