KEGG   Geobacillus thermodenitrificans: GTNG_1830Help
Entry
GTNG_1830         CDS       T00496                                 

Definition
(GenBank) Guanidinobutyrase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00330  Arginine and proline metabolism
gtn01100  Metabolic pathways
Module
gtn_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GTNG_1830
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GTNG_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Ehbp
Motif
Other DBs
NCBI-ProteinID: ABO67190
UniProt: A4IPD6
Position
1949168..1950142
Genome map
AA seq 324 aa AA seqDB search
MYKPKDSSQSPRFCGVRTFMRLEQVKTTDHVDFVVLGVPFDTAASNRTGQRYGPQHIRNF
SVLLRPYNPDMDIDIFAYCSGVDYGDVDVVPGNVLRTYDRIVEELRPLLKKDIIPILMGG
DHSITLGHLRAFYERFGPVALVHFDSHSDTWDHYYGEKYMHGTPFRRAVEEGLLDVDHSI
QVGMRGPLYSADDIEDARRLGFEVIPMKEVRQIGFTEVMRRIHQRVGNKPVFVSYDIDFV
DPAFAPGTGTPEVGGPTSYEALEYVRGLDGLNIVGFDLVEVLPAYDSGEITAALASAIMY
EMITLVALKKKRSQANNLSAATTP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaccaaaagattcttcccagtcgccccgtttttgcggggttcgtacctttatg
cgattagaacaggtcaaaacaaccgaccatgtggattttgttgtgctcggtgtgccgttt
gataccgcggcctcaaaccgcactggtcaacgatacggcccgcagcatattcgaaatttt
tccgtcctgcttcgcccttacaatcccgacatggatattgatatttttgcttattgttcg
ggtgtcgattacggggatgtggatgtcgttcccggcaatgtgctgcgcacatacgatcgt
atcgttgaagagctgcgcccattgttgaagaaagatatcatcccgattctcatgggcggt
gaccactctattacattgggacacttgcgcgctttttacgaacgctttgggcctgtcgca
ctcgttcattttgactcgcatagcgatacgtgggatcattactatggagaaaaatatatg
cacggtacgccgttccgccgcgctgttgaggaaggattgctcgatgtagatcattccatt
caagtcggtatgcgcggaccgctttacagcgccgatgatatcgaagacgcacggcggctt
ggttttgaagtcattccgatgaaagaagtccgccaaattggttttacagaagtgatgcgt
cgcattcatcaacgcgttgggaacaaacccgttttcgtttcctacgatatagactttgtt
gatcctgcgtttgcgccaggtaccggcacaccagaagtgggcgggccgacgagctacgag
gcgcttgaatacgtaagaggactcgatgggctaaacatcgtcggatttgatctcgtcgaa
gtattgcctgcttacgacagcggagaaattacagcagcattggcctctgcaattatgtac
gagatgattacgcttgtggcattaaagaaaaagcggtcacaggccaacaatttgtcagca
gcgacaacaccataa

DBGET integrated database retrieval system