KEGG   Geobacillus thermodenitrificans: GTNG_1830Help
Entry
GTNG_1830         CDS       T00496                                 

Definition
guanidinobutyrase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gtn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949168..1950142
Genome map
AA seq 324 aa AA seqDB search
MYKPKDSSQSPRFCGVRTFMRLEQVKTTDHVDFVVLGVPFDTAASNRTGQRYGPQHIRNF
SVLLRPYNPDMDIDIFAYCSGVDYGDVDVVPGNVLRTYDRIVEELRPLLKKDIIPILMGG
DHSITLGHLRAFYERFGPVALVHFDSHSDTWDHYYGEKYMHGTPFRRAVEEGLLDVDHSI
QVGMRGPLYSADDIEDARRLGFEVIPMKEVRQIGFTEVMRRIHQRVGNKPVFVSYDIDFV
DPAFAPGTGTPEVGGPTSYEALEYVRGLDGLNIVGFDLVEVLPAYDSGEITAALASAIMY
EMITLVALKKKRSQANNLSAATTP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaccaaaagattcttcccagtcgccccgtttttgcggggttcgtacctttatg
cgattagaacaggtcaaaacaaccgaccatgtggattttgttgtgctcggtgtgccgttt
gataccgcggcctcaaaccgcactggtcaacgatacggcccgcagcatattcgaaatttt
tccgtcctgcttcgcccttacaatcccgacatggatattgatatttttgcttattgttcg
ggtgtcgattacggggatgtggatgtcgttcccggcaatgtgctgcgcacatacgatcgt
atcgttgaagagctgcgcccattgttgaagaaagatatcatcccgattctcatgggcggt
gaccactctattacattgggacacttgcgcgctttttacgaacgctttgggcctgtcgca
ctcgttcattttgactcgcatagcgatacgtgggatcattactatggagaaaaatatatg
cacggtacgccgttccgccgcgctgttgaggaaggattgctcgatgtagatcattccatt
caagtcggtatgcgcggaccgctttacagcgccgatgatatcgaagacgcacggcggctt
ggttttgaagtcattccgatgaaagaagtccgccaaattggttttacagaagtgatgcgt
cgcattcatcaacgcgttgggaacaaacccgttttcgtttcctacgatatagactttgtt
gatcctgcgtttgcgccaggtaccggcacaccagaagtgggcgggccgacgagctacgag
gcgcttgaatacgtaagaggactcgatgggctaaacatcgtcggatttgatctcgtcgaa
gtattgcctgcttacgacagcggagaaattacagcagcattggcctctgcaattatgtac
gagatgattacgcttgtggcattaaagaaaaagcggtcacaggccaacaatttgtcagca
gcgacaacaccataa

DBGET integrated database retrieval system