KEGG   Geobacillus thermodenitrificans: GTNG_1932Help
Entry
GTNG_1932         CDS       T00496                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTNG_1932
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GTNG_1932
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GTNG_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2056522..2057646
Genome map
AA seq 374 aa AA seqDB search
MKRQRVVVKIGSSSLTDPKGGLCHDKLLDHVQAIAYMKQLGHDIILITSGAVAAGFGPLG
YPTRPTTIAGKQAAAAVGQSLLMQAYSAQFAQFGFTAAQLLLTRSDFYSRERFRNLFATI
TTLLEHGAVPIINENDSVSVEELTFGDNDMLSALVAGFLHADALVLLTDINGLYDANPKT
NPQAKKYAFLPEITSEMLASAGGSGSTVGTGGMRSKLLAAQKALSFGVSVFIGTGSGKEK
LADILAGKGDGTYIGVPFPKQMQMRKQWIAYHAPVSGTITVDSGAEEALLDRGKSLLPAG
VTAVSGDFHAMDVVNVINEKGVTIGRGQVYYAAADLKKVKGRPSEEARQYSYLHRPEVIH
RDNWVTLRKERVKR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcagcgcgtcgttgtgaaaatcgggagcagctcactcaccgatccaaaaggc
ggcctttgccatgataaactgcttgatcatgttcaagcgatcgcttatatgaaacagctc
ggccatgacatcattctcatcacatccggtgcagttgcggccggcttcgggccgttaggc
tacccaacgcggccgacgacgatcgccggcaaacaggcggctgctgccgtcggacaaagc
ttattgatgcaggcgtacagcgcacagttcgcccaattcggcttcaccgccgcccagttg
ttgttgacgcgcagcgatttttacagccgtgagcgatttcgcaacttgtttgccacgatc
accacattactcgaacacggcgccgtgccgatcattaacgaaaacgactccgtttccgtc
gaagagttgacgttcggcgacaatgatatgttgtcagcgcttgtggcaggcttcttgcat
gccgatgcgctcgttttgctcactgacattaacgggctgtacgacgccaatccgaaaacg
aacccgcaggcgaaaaaatacgcctttttgccagagattacgagcgagatgctcgcctca
gccggcggcagcggctcgactgtcggcaccggcggcatgcgctcaaagctgttagctgcg
caaaaagctctctccttcggcgtcagcgtcttcatcggcacgggaagcggcaaagaaaaa
ctggctgatattttagctggaaaaggtgacggtacatacatcggtgttccttttccgaaa
cagatgcaaatgcgcaagcaatggatcgcctatcacgcccccgtttccggcacaatcact
gtggacagcggcgccgaggaagcgctgcttgaccgcgggaaaagtttgctgccggccggc
gtcacggcggtttccggcgactttcatgcgatggatgtcgtcaatgtcatcaacgaaaaa
ggcgttaccatcggccgcggtcaagtatattacgccgccgccgatttgaaaaaagtgaaa
gggcggccgagcgaagaagcgcggcaatactcttaccttcaccgcccggaagtcatccac
cgcgacaattgggtcactttgcgaaaggagcgtgtcaaaagatga

DBGET integrated database retrieval system