KEGG   Geobacillus thermodenitrificans: GTNG_2133Help
Entry
GTNG_2133         CDS       T00496                                 

Definition
(GenBank) Tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTNG_2133
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTNG_2133
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GTNG_2133
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GTNG_2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2264522..2265328)
Genome map
AA seq 268 aa AA seqDB search
MRLPVNRSLFIPFIVAGDPSADLTVDLALALQDAGADVLELGVPYSDPLADGPTIQRAAA
RALAGQMTLPKAIQLVADMRKKGVKIPIIIFTYYNPVLQLGEESFFALAQENGADGVLIP
DLPFEESGPLLELSERFGLPLISLVAPTSKQRIEQIASAAQGFLYCVSSLGVTGVRETLP
ESLGHFLGEVKRHSRVPVVVGFGISTPEQVAMLKDACDGVVVGSALVQKIEQLLERLQTL
EEKNAAIAEFASYARSLAAPLREPCSSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtctgcccgttaaccgatcgttatttattccgtttattgttgccggcgacccgtct
gctgatttgactgttgacctcgctttggcgctgcaagacgccggtgctgacgtgttggag
cttggcgttccgtactctgacccactcgctgatgggccgacgatccagcgcgccgccgcc
cgggcgctcgccggacaaatgacgctgccgaaagccattcaacttgttgccgacatgcga
aaaaaaggagtaaaaattccgattattatctttacgtattataatcctgtgttacaatta
ggagaagaatccttttttgctttagcgcaagaaaatggcgccgacggcgtgctcattccc
gacttgccgtttgaggagagcggcccgctcctcgagctcagtgagcggttcggacttccg
cttatttcgcttgtcgctccgacatcaaagcagcgaattgagcagattgcttcagcggcg
caggggtttttgtactgtgtctcctcgcttggcgtcacgggcgtgcgtgagacactgccg
gagtcgcttggccatttcctaggtgaagtaaagcggcatagccgtgtcccggtcgttgtc
ggtttcggcatttcaacaccggaacaagtggcgatgctgaaagacgcctgtgatggcgtc
gtggtcggcagtgcgctcgtgcaaaaaatcgaacagttgcttgagcgcctgcagaccttg
gaagaaaagaatgcggctatcgctgaatttgcctcctatgcccgttcgctcgccgcgccg
cttcgggagccgtgttcttcgcgctaa

DBGET integrated database retrieval system