KEGG   Geobacillus thermodenitrificans: GTNG_2134Help
Entry
GTNG_2134         CDS       T00496                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTNG_2134
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTNG_2134
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GTNG_2134
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GTNG_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2265312..2266526)
Genome map
AA seq 404 aa AA seqDB search
MEHVPNEHGRFGDFGGKFVPETLMLPLEEIETELDKALADESFRQEYIRILQHYSGRPTP
LTFAPNLTRQLGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHGV
AAATVAAHFGMECIVFMGEEDMKRQELNVFRMKLLGAEVVPVLSGNRTLKDATNEAIRYW
VAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLAGEGTLPDVIVACVGGGSNA
IGMFYPFLQDDVRLVGVEAAGKGIDTPHHAATIAKGTKGVIHGAMTYLLQDEYGQIIEPY
SISAGLDYPGVGPEHAYLASIGRVRYESVTDEEAVAAFQLLAQTEGIIPAIESAHAVAKA
VELARQMTPDETVLICLSGRGDKDVQMMMHHLGVKEGEDVASAR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaacacgttccgaatgaacacgggcgatttggtgattttggcggcaagtttgttcca
gagacgctcatgctcccccttgaggaaattgaaaccgagctggacaaagcgcttgccgac
gagtcgttcaggcaagaatatatccggattttgcagcactactcggggcggccgactccg
cttacgtttgcaccaaatttgacacgacagcttggtggggcgaaaatttatttaaagcgc
gaagatttaaaccacaccggcgcccataaaatcaacaacgctatcggccaggcgctcttg
gcgaaacggatgggcaagaaaaagttgatcgctgagaccggcgctgggcagcacggggtt
gcggcagcgacggtggccgctcacttcggtatggaatgcatcgtctttatgggcgaggaa
gacatgaagcggcaagagttgaacgtgtttcggatgaagctgttaggcgccgaagttgtg
ccggtgttaagcggcaaccggacgttaaaagatgcgacaaatgaggcgattcgttattgg
gtcgcccattgcgatgaccatttttacatgatcggttcggttgtcggcccgcatccgtac
ccgaaaatggtgcgcgagtttcagcgcgtgatcggcgatgaggcgaaagaacagtttctc
gccggcgaaggaacgctgccggatgtgattgttgcctgcgtcggcggaggcagcaacgcc
atcggcatgttttatccgtttttgcaagacgatgtccgtctcgtcggcgtggaagcggcc
ggcaaaggaatcgatactccgcaccatgcggcgacgattgcaaaagggacaaaaggcgtt
atccatggggcaatgacgtacttgttacaagatgagtacgggcaaattattgaaccgtat
tcaatttccgccggccttgattaccctggcgtcggtccggaacatgcgtatttggccagc
atcggccgcgttcgttatgagagtgtgaccgatgaagaagcagtggctgcgtttcagctt
ctggcgcaaactgaaggcatcattccagccattgagtcggcgcatgcggtggccaaagct
gtcgagcttgcccgccaaatgacgccggatgagacggtgcttatttgcctgtccggccgc
ggcgataaagatgtgcaaatgatgatgcaccatcttggggtgaaagaaggtgaagacgtt
gcgtctgcccgttaa

DBGET integrated database retrieval system