KEGG   Geobacillus thermodenitrificans: GTNG_2196Help
Entry
GTNG_2196         CDS       T00496                                 

Gene name
cobD
Definition
cobalamin biosynthesis protein
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gtn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2318826..2319797)
Genome map
AA seq 323 aa AA seqDB search
MTHLLALTLALFLDALFGDPRWLPHPVRGMGGLIAYFDQRWNQGSGRRAKGVAAVAAVLA
IVYGVSALIVHMSYALSVYIGVAVEAVLIFTTIATKSLAEAAEDVRRPLEAGDLPEARRA
LSMIVGRDTKRLDEAGITRACVETVAENTSDGVTAPLFYAAIGGAPLALLYRAVNTCDSM
IGYKNEKYGEFGWAAARLDDVLNYIPARLTALVMVFIYGGRRLRRSLAVLFRDARRHPSP
NSGWLEAAMAGLLGVQLGGTNTYGGVVSERPTIGRPDVPLRSVHIRRAVGIMIGTVLVFT
LWLWIGGMIVVLAGAWGESARAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatctgttggcgctgacgttggcattgtttcttgacgcactgtttggtgacccg
cgctggctgccgcatccggtgcgcgggatgggaggactgattgcttatttcgaccagcgc
tggaatcaaggaagcggccgccgggctaagggcgtggcggccgtggccgccgtgctggcc
atcgtgtatggggtgtccgcgctcatcgttcatatgagctatgccttgtcagtatacatt
ggcgtggcggtcgaagcggtgctcatttttacgactattgcgacaaaaagtcttgctgaa
gcagctgaggatgtgcggcggccgctcgaagcgggcgatctcccggaggcgcggcgcgcg
ctgtcgatgatcgtcggccgcgataccaagcggctcgatgaagccggcattacccgtgcc
tgcgtggaaacggtggcggaaaatacgagcgacggcgttaccgcccctctcttttacgca
gccattggtggagcgccgctcgccttattgtatcgggcggtgaacacgtgcgattcgatg
atcggttataaaaatgagaagtatggcgaatttggctgggcagccgctcggctggatgat
gtgctgaactatattccggctcggttgacggcacttgtcatggtgttcatttatggtggt
cgccggcttcgtcgctctttggcagttttgtttcgcgatgcccgccgccatccgagcccc
aacagcggttggctcgaggcggcgatggctgggctgctcggggtgcagctgggtggaacg
aatacatatggtggcgttgtttccgagcggccgacgatcggccgcccggacgtcccgctt
cgctccgtccatattcgtcgggcggtcggcatcatgatcggaacggtgcttgtttttacg
ttatggctatggatcggagggatgatcgttgtattggccggcgcatggggcgaatccgca
cgcgctctataa

DBGET integrated database retrieval system