KEGG   Geobacillus thermodenitrificans: GTNG_2473Help
Entry
GTNG_2473         CDS       T00496                                 

Definition
cystathionine beta-lyase
Orthology
K17217  
cystathionine gamma-lyase / homocysteine desulfhydrase [EC:4.4.1.1 4.4.1.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Cysteine biosynthesis, methionine => cysteine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gtn01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gtn00920]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gtn00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gtn00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2577260..2578393)
Genome map
AA seq 377 aa AA seqDB search
MRRKTLLIHGGIPGDPHTGAVSVPIYQVSTYKQEEVGKHKGFEYSRTGNPTRAALEKLIA
DLEGGEAGFAFASGMAAITAVMMLFDSGDHIVLTDDVYGGTYRVMANVLNRFGLESTFVD
TSDIANIEAHIRPNTKAIYIETPTNPLLKITDLKAAAAIARAHGLLLIVDNTFSTPYFQT
PLELGADIVIHSATKYLGGHSDVVAGLAVVRTAELAERLHYVQNSTGGILGPQDSWLLMR
GMKTLGVRMEEHEQNARAIAAFLAEHQAVTRVYYPGLPEHPNHELAKAQMRGFGGMISFD
VGSLERAETVLSRVRYFTLAESLGAVESLISLPGKMTHASIPKERREQLGITDGLIRLSV
GLEDVNDLIDDLAQALG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaaaaacgttgctcattcatggcggcattccgggtgacccgcatacaggggcg
gtgtcggtgccgatttatcaagtgagtacgtacaagcaagaagaagttggaaagcataaa
ggatttgaatactcgcgtaccggcaacccgacgcgtgcagcgctcgaaaaactgattgct
gacctcgaaggcggcgaggccgggttcgcgttcgcttccggaatggcggcgattacggcc
gtcatgatgctgtttgacagcggggatcatattgtgctcaccgatgacgtttacggcggc
acgtatcgagtgatggcgaacgtgttaaaccgattcggattggaatcgacgttcgtcgat
acgagcgacatcgccaacatagaggcgcacattcgtccaaatacgaaagccatttacatt
gagacaccgacgaatccgttgttgaaaatcacggatttgaaggccgccgccgccattgcc
cgtgcgcacgggctgctattgatcgtcgataacacgttttcgacaccgtactttcaaacg
ccgcttgagcttggcgctgatatcgtcatccatagcgcgacgaaatatttaggcggtcat
agtgacgtcgtcgccggactggctgttgtccgcaccgccgagctcgccgagcggcttcat
tacgtgcaaaattcgacgggcggcatccttggaccgcaagattcgtggctgcttatgcgc
gggatgaaaacgcttggcgtgcggatggaagagcatgaacaaaatgcgcgggcaattgcc
gcctttttggcggagcatcaggcggttacccgcgtgtattatcctgggcttccggagcat
ccgaaccatgagctggcgaaagcacaaatgcgtgggttcggcggcatgatttcgttcgat
gtcggcagccttgagcgcgctgaaacggtgctgtcgcgtgtccgctactttacgctagct
gaaagtttaggggcagtcgaaagcttaatttcattgccagggaaaatgacacatgcgtcg
atcccgaaagagcggcgtgaacagctcggcattactgatgggctcatccgtctatcggtc
ggccttgaagacgtcaatgatttgattgacgatttggcgcaagcgcttggttga

DBGET integrated database retrieval system