KEGG   Geobacillus thermodenitrificans: GTNG_2473Help
Entry
GTNG_2473         CDS       T00496                                 

Definition
cystathionine beta-lyase
Orthology
K17217  
cystathionine gamma-lyase / homocysteine desulfhydrase [EC:4.4.1.1 4.4.1.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTNG_2473
  Energy metabolism
   00920 Sulfur metabolism
    GTNG_2473
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTNG_2473
   00270 Cysteine and methionine metabolism
    GTNG_2473
Enzymes [BR:gtn01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     GTNG_2473
    4.4.1.2  homocysteine desulfhydrase
     GTNG_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2577260..2578393)
Genome map
AA seq 377 aa AA seqDB search
MRRKTLLIHGGIPGDPHTGAVSVPIYQVSTYKQEEVGKHKGFEYSRTGNPTRAALEKLIA
DLEGGEAGFAFASGMAAITAVMMLFDSGDHIVLTDDVYGGTYRVMANVLNRFGLESTFVD
TSDIANIEAHIRPNTKAIYIETPTNPLLKITDLKAAAAIARAHGLLLIVDNTFSTPYFQT
PLELGADIVIHSATKYLGGHSDVVAGLAVVRTAELAERLHYVQNSTGGILGPQDSWLLMR
GMKTLGVRMEEHEQNARAIAAFLAEHQAVTRVYYPGLPEHPNHELAKAQMRGFGGMISFD
VGSLERAETVLSRVRYFTLAESLGAVESLISLPGKMTHASIPKERREQLGITDGLIRLSV
GLEDVNDLIDDLAQALG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagacgaaaaacgttgctcattcatggcggcattccgggtgacccgcatacaggggcg
gtgtcggtgccgatttatcaagtgagtacgtacaagcaagaagaagttggaaagcataaa
ggatttgaatactcgcgtaccggcaacccgacgcgtgcagcgctcgaaaaactgattgct
gacctcgaaggcggcgaggccgggttcgcgttcgcttccggaatggcggcgattacggcc
gtcatgatgctgtttgacagcggggatcatattgtgctcaccgatgacgtttacggcggc
acgtatcgagtgatggcgaacgtgttaaaccgattcggattggaatcgacgttcgtcgat
acgagcgacatcgccaacatagaggcgcacattcgtccaaatacgaaagccatttacatt
gagacaccgacgaatccgttgttgaaaatcacggatttgaaggccgccgccgccattgcc
cgtgcgcacgggctgctattgatcgtcgataacacgttttcgacaccgtactttcaaacg
ccgcttgagcttggcgctgatatcgtcatccatagcgcgacgaaatatttaggcggtcat
agtgacgtcgtcgccggactggctgttgtccgcaccgccgagctcgccgagcggcttcat
tacgtgcaaaattcgacgggcggcatccttggaccgcaagattcgtggctgcttatgcgc
gggatgaaaacgcttggcgtgcggatggaagagcatgaacaaaatgcgcgggcaattgcc
gcctttttggcggagcatcaggcggttacccgcgtgtattatcctgggcttccggagcat
ccgaaccatgagctggcgaaagcacaaatgcgtgggttcggcggcatgatttcgttcgat
gtcggcagccttgagcgcgctgaaacggtgctgtcgcgtgtccgctactttacgctagct
gaaagtttaggggcagtcgaaagcttaatttcattgccagggaaaatgacacatgcgtcg
atcccgaaagagcggcgtgaacagctcggcattactgatgggctcatccgtctatcggtc
ggccttgaagacgtcaatgatttgattgacgatttggcgcaagcgcttggttga

DBGET integrated database retrieval system