KEGG   Geobacillus thermodenitrificans: GTNG_2494Help
Entry
GTNG_2494         CDS       T00496                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gtn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2595629..2597992)
Genome map
AA seq 787 aa AA seqDB search
MQEQQSLALDGRTFIKGVCLAVIFHNEETLYTVVRIRVEETNEAAAEEEVVVTGYFPRLN
EGDVYIFYGQFRQHPRFGRQYAAEQFRKQLPNTKEGVIDYLSSGLFKGIGKKTATAIVDA
LGENAIAAILRDPGALERVPKLTKQKAKQLYETLCAHEGLEQTMIALAQLGFGPQLAMKI
YQVYGEETMDIIHENPYKLVEDIEGIGFGRADELGRQLGISGSHPARLRAACLFVLEQAC
LQEGHVYMKKEELVSRIGELLGGRSNGAVDGQAIEQTLLMLSEEGKMIAEQGRYYLPSLY
FAEKGIASNIRRLLGQTPPSASFPESEFLLALGALEERLGMQYAPQQKEAIQRALSSPLF
ILTGGPGTGKTTVIKGIVELFAVLNGISLSPDDYKNGEPFPVLLAAPTGRAAKRMSEATG
LPAATIHRLLGWNGAEGFSHDENEPIAGKLLVVDEVSMVDTWLANHLLKAVPNGMQVIFV
GDEDQLPSVGPGQVLKDLLESGVIPSVRLTEVYRQAEGSSIIELAHEMKRGNVPADLTAP
KADRSFIRCRAGQVASVVRQIAENARNKGFSVKDIQVLAPMYRGPAGIDQLNKVLQELFN
PPTDGKRELSVGDVVYRVGDKVLQLVNQPEDNVFNGDIGEVVAIFYAKENTEKQDLLVVS
FDGIEVTYTRQDLAQITHAYCCSVHKAQGSEFPIVILPVVKSYYRMLKRNLLYTAVTRSK
QFLILCGEEEAFRFGVAQRGDGARQTALAEKLAASTALFVEGELPLEDANIGMENVTPYD
FMDDGSS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagagcagcaatcgcttgcgctggacggccgcacgtttattaaaggggtgtgtttg
gccgtcatttttcataacgaggagacgttgtataccgttgtccgtatccgcgtcgaagaa
acgaatgaagcggctgcggaggaagaagtggtcgtcaccggctattttccacgtttaaat
gaaggggacgtgtacatcttttacgggcaattccgccaacatccgcgctttggccgccag
tatgcggccgagcagttccgcaaacagcttccgaacacgaaagaaggagtcatcgattat
ttgtcgagcggcttgtttaaggggatcggcaaaaaaacagcgacagcgattgtcgatgcg
cttggtgaaaacgcgatcgccgccattttgcgtgatccaggagcgctcgaacgcgtgccc
aagctgacgaaacaaaaagcgaagcaattgtacgaaacgctctgcgcccacgaagggctc
gaacagacgatgatcgccctcgctcagctcggttttggtccacagctggcaatgaaaatt
taccaagtatacggcgaagagacaatggacatcattcatgaaaacccgtacaagctcgtc
gaagatattgaagggatcggttttggtcgcgccgatgagctcgggcggcagctcggcatt
tccggcagtcatccagcccggctgcgcgccgcttgtctgtttgtccttgagcaggcatgc
ttgcaagaagggcacgtctacatgaagaaagaagagctcgtcagccgcattggggagctg
cttggcggaaggtcgaacggagcggttgatggacaagccatcgaacagacgctccttatg
ttaagcgaagaaggaaagatgatcgcggaacaaggccgctattatcttccttcgctttac
ttcgccgaaaaagggatcgcttctaacattcggcggttgctcgggcaaacgccaccatcg
gcctcatttccggagtcggagtttttgctggcgctcggggcgcttgaagaacgactcggg
atgcaatatgctccgcagcaaaaagaagcgattcaacgggcgctgtcttcgccgctcttt
attttgacgggaggtccaggaacaggaaaaacaacggtcattaaaggaattgttgagctg
tttgcggttctaaatggcatatcactttcccccgacgattacaaaaacggtgaaccgttt
cctgtgctgctcgctgctccgactggacgggctgcaaagcggatgagtgaggcgaccggg
ctgccggcggcgacgattcaccggctgctcggctggaatggagcggaagggttcagccac
gatgaaaatgagccgattgccggtaagctgcttgtcgtcgatgaggtgtcgatggtcgat
acgtggttggctaatcacctgttaaaagcggtgcctaatgggatgcaagtcatcttcgtt
ggcgatgaagaccagcttccatccgtcgggccagggcaagtgttgaaagatttgctcgag
tcgggtgttatcccgtccgtgcggctgaccgaggtgtaccgccaggcggaagggtcatcg
attatcgagctcgcccatgagatgaagcgtggaaacgtgccggccgacttgactgccccg
aaggcggatcgttcgttcatccgctgccgcgccggacaagtggctagtgtcgtgcgtcaa
atcgccgaaaatgcgcgtaacaaagggttttccgtcaaagacattcaagtgctcgctccg
atgtaccgcggcccagccggtatcgatcagctaaacaaagtgctgcaggagctgtttaat
ccaccaacggatgggaagcgagaactttccgttggcgacgtagtgtatcgcgtcggcgat
aaagtgctccagctcgtcaatcaaccggaagacaacgtgtttaacggcgatatcggtgaa
gtcgtggccattttttatgccaaagaaaatacagaaaagcaagatttgctcgtcgtctca
tttgacggcattgaagtgacgtatacaaggcaagatttagcgcaaattacccatgcatat
tgctgctccgtccataaggcgcaagggagcgagtttccgattgtcattttgcctgttgtc
aaaagttattaccggatgttgaagcggaatttgttgtatacggcggtgacaagaagcaaa
caatttctgattttatgcggggaggaagaagcattccggtttggtgttgcccagcggggc
gacggagcgcgccagacggcgcttgcagaaaagttggcggcttcgactgcgctgtttgtc
gaaggggaactgccgcttgaggatgcgaacatcgggatggaaaacgttacgccgtatgac
tttatggacgatgggtcaagctaa

DBGET integrated database retrieval system