KEGG   Geobacillus thermodenitrificans: GTNG_2615Help
Entry
GTNG_2615         CDS       T00496                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Fatty acid degradation
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GTNG_2615
  Lipid metabolism
   00071 Fatty acid degradation
    GTNG_2615
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTNG_2615
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GTNG_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2722373..2723146)
Genome map
AA seq 257 aa AA seqDB search
MEHFRLTKEEFVAVVTFSRPPANALSSAVLKELSNILDELEADSDVRVVLLHGEGRFFSA
GADIKEFTSVASAEEASALSRNGQLVVERIERFSKPVIAAIHGAALGGGLELAMSYRIRL
VTENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTGEPITGLEAVQWGLANKAV
PEERLLDEAKQLAHKIAAKSPLSVRATIELLNAAKEKSFAEAVRDEAEWFGRVFVSEDGR
EGVQAFLEKRPPVFQGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagcattttcgcttgacaaaagaggaattcgtcgctgtcgtgacgttttcgcggccg
ccggcgaatgctctttcatctgctgttttgaaagagctttcaaatatcttggatgagctc
gaggccgactcggacgtgcgtgtcgtgctgttgcatggtgaaggccggtttttctcggct
ggcgcggatattaaagagtttacgtccgtcgcttctgccgaggaagcgtccgctttgtcg
cgcaacggccagctggttgtagagcggattgagcggttttccaagccggtgattgctgct
attcatggcgccgcgttgggtggaggacttgagttggcgatgagctaccgtattcgtttg
gtgacagaaaatgcgaagcttggcctgccagagctgcagcttggcatcattccagggttt
gccggcacgcagcggctcgtgcgctacgttgggttcggcaaggcggcggaaatgatgtgg
acaggcgagccgatcaccggcttagaggctgtgcagtgggggctggccaacaaggcggtg
cctgaagagcggcttcttgatgaagcgaaacagttagcgcacaaaatcgctgcaaaaagc
ccgctttccgttcgcgccacgattgagcttctcaatgcggcgaaagaaaaatcgttcgct
gaggcggtgcgcgacgaagcggaatggtttggccgtgtgtttgtttccgaggatgggaga
gaaggtgtgcaggcgtttttagaaaaacgtccccccgtctttcaagggaaataa

DBGET integrated database retrieval system