KEGG   Geobacillus thermodenitrificans: GTNG_2615Help
Entry
GTNG_2615         CDS       T00496                                 

Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gtn01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gtn00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2722373..2723146)
Genome map
AA seq 257 aa AA seqDB search
MEHFRLTKEEFVAVVTFSRPPANALSSAVLKELSNILDELEADSDVRVVLLHGEGRFFSA
GADIKEFTSVASAEEASALSRNGQLVVERIERFSKPVIAAIHGAALGGGLELAMSYRIRL
VTENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTGEPITGLEAVQWGLANKAV
PEERLLDEAKQLAHKIAAKSPLSVRATIELLNAAKEKSFAEAVRDEAEWFGRVFVSEDGR
EGVQAFLEKRPPVFQGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagcattttcgcttgacaaaagaggaattcgtcgctgtcgtgacgttttcgcggccg
ccggcgaatgctctttcatctgctgttttgaaagagctttcaaatatcttggatgagctc
gaggccgactcggacgtgcgtgtcgtgctgttgcatggtgaaggccggtttttctcggct
ggcgcggatattaaagagtttacgtccgtcgcttctgccgaggaagcgtccgctttgtcg
cgcaacggccagctggttgtagagcggattgagcggttttccaagccggtgattgctgct
attcatggcgccgcgttgggtggaggacttgagttggcgatgagctaccgtattcgtttg
gtgacagaaaatgcgaagcttggcctgccagagctgcagcttggcatcattccagggttt
gccggcacgcagcggctcgtgcgctacgttgggttcggcaaggcggcggaaatgatgtgg
acaggcgagccgatcaccggcttagaggctgtgcagtgggggctggccaacaaggcggtg
cctgaagagcggcttcttgatgaagcgaaacagttagcgcacaaaatcgctgcaaaaagc
ccgctttccgttcgcgccacgattgagcttctcaatgcggcgaaagaaaaatcgttcgct
gaggcggtgcgcgacgaagcggaatggtttggccgtgtgtttgtttccgaggatgggaga
gaaggtgtgcaggcgtttttagaaaaacgtccccccgtctttcaagggaaataa

DBGET integrated database retrieval system