KEGG   Geobacillus thermodenitrificans: GTNG_2615Help
Entry
GTNG_2615         CDS       T00496                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase family protein
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00071  Fatty acid degradation
gtn00362  Benzoate degradation
gtn01100  Metabolic pathways
gtn01120  Microbial metabolism in diverse environments
gtn01212  Fatty acid metabolism
Module
gtn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    GTNG_2615
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTNG_2615
Enzymes [BR:gtn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GTNG_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABO67960
UniProt: A4IRK6
Position
complement(2722373..2723146)
Genome map
AA seq 257 aa AA seqDB search
MEHFRLTKEEFVAVVTFSRPPANALSSAVLKELSNILDELEADSDVRVVLLHGEGRFFSA
GADIKEFTSVASAEEASALSRNGQLVVERIERFSKPVIAAIHGAALGGGLELAMSYRIRL
VTENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTGEPITGLEAVQWGLANKAV
PEERLLDEAKQLAHKIAAKSPLSVRATIELLNAAKEKSFAEAVRDEAEWFGRVFVSEDGR
EGVQAFLEKRPPVFQGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagcattttcgcttgacaaaagaggaattcgtcgctgtcgtgacgttttcgcggccg
ccggcgaatgctctttcatctgctgttttgaaagagctttcaaatatcttggatgagctc
gaggccgactcggacgtgcgtgtcgtgctgttgcatggtgaaggccggtttttctcggct
ggcgcggatattaaagagtttacgtccgtcgcttctgccgaggaagcgtccgctttgtcg
cgcaacggccagctggttgtagagcggattgagcggttttccaagccggtgattgctgct
attcatggcgccgcgttgggtggaggacttgagttggcgatgagctaccgtattcgtttg
gtgacagaaaatgcgaagcttggcctgccagagctgcagcttggcatcattccagggttt
gccggcacgcagcggctcgtgcgctacgttgggttcggcaaggcggcggaaatgatgtgg
acaggcgagccgatcaccggcttagaggctgtgcagtgggggctggccaacaaggcggtg
cctgaagagcggcttcttgatgaagcgaaacagttagcgcacaaaatcgctgcaaaaagc
ccgctttccgttcgcgccacgattgagcttctcaatgcggcgaaagaaaaatcgttcgct
gaggcggtgcgcgacgaagcggaatggtttggccgtgtgtttgtttccgaggatgggaga
gaaggtgtgcaggcgtttttagaaaaacgtccccccgtctttcaagggaaataa

DBGET integrated database retrieval system