KEGG   Geobacillus thermodenitrificans: GTNG_2628Help
Entry
GTNG_2628         CDS       T00496                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gtn00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:gtn00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:gtn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2737090..2738364
Genome map
AA seq 424 aa AA seqDB search
MFKSKRCAALLIATLSVGLTLNHGGQAISAAPSKPAKPPVVKNVIMLVGDGMGTAQRNAI
RLATKGIDGELEMDSMPYSGLIHTNSADPKSFITDSAAAASAIATGVKTYNGAISVDLQG
KPVKTILEQAKKAGKATGLVTTAQVTDATPAAFAAHTANRSAQSDIAKQYIEKTKVDVIL
GGGEDYWYPAGHPGYYPDTAEDAEEGSKGKQGNLVERAKKLGYTYVRTADELKRAKGRKL
LGLFANEEMFQKRSEGEGKYNPVVSLPDMTKKAIDVLSKNKKGFFLVVEEEAIDEMSHDN
NGSLMIKAGQQFDQAVAVAKRYAKHHPDTLVLVLADHESGGLTIETPGDADESEDSNTLS
DENGPFAVAHSKQTFTLNWTTTGHTAAGVPLTAMGPGAKRFAGVYENTHIHDILETLLFG
KRER
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatcgaaacgctgcgctgctctacttatcgctacgctaagtgtcggactcacg
ctcaaccatggcggacaagcaatatcggctgcaccgtccaagcccgcaaagccacctgtc
gtgaaaaatgtcatcatgctcgtcggcgacggtatgggaacagcccagcgcaatgccatt
cgcctagcgacgaaagggatagacggggaactagaaatggacagcatgccatacagcggg
ctcattcatacaaactccgccgaccccaaatcattcatcaccgactccgctgcggctgcc
agcgcgatagcgacaggtgtaaaaacgtataacggcgccatctccgttgacttacaagga
aaaccggtgaaaacgattttggaacaagcgaaaaaagccgggaaagcgaccgggcttgtc
acgactgcccaagtaaccgatgctaccccagcggcattcgctgctcacaccgccaatcgc
tccgcacaaagcgacatcgccaagcaatacatcgaaaaaaccaaagttgacgtcattttg
ggcggcggggaagactactggtatccagctggacatcctggctattacccagatacggct
gaagatgcagaagaaggaagcaaaggcaagcaaggaaacttagttgaacgcgccaagaag
ctcggttacacctatgtccgcaccgccgatgagctgaaacgggcaaaggggcgcaaactg
cttggattattcgccaatgaagaaatgttccaaaaacgttccgaaggagaaggtaagtac
aaccccgtcgtatcgctgcctgatatgacaaaaaaagcgattgatgtgttgtcgaaaaac
aaaaaaggctttttccttgtcgtcgaagaggaagcgattgatgaaatgagccatgacaat
aacggttcgctcatgatcaaagcggggcaacagtttgatcaagcagtcgccgtggcgaaa
cggtacgccaagcaccatccagacacactcgttcttgtgctcgccgaccacgaatccggc
ggcctgacgattgaaacgccgggcgacgcagatgaatcagaagacagtaacacgctctct
gacgaaaacggcccgtttgccgtcgcccattctaaacaaacattcaccttaaactggacg
acaacaggccacactgctgccggtgtgccactgaccgccatgggtccgggagcgaaacgg
tttgctggcgtgtatgaaaatacgcacattcatgacattcttgagacgttattgtttgga
aaaagagaaagataa

DBGET integrated database retrieval system