KEGG   Geobacillus thermodenitrificans: GTNG_2637Help
Entry
GTNG_2637         CDS       T00496                                 

Definition
M42 family peptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GTNG_2637
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GTNG_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2746475..2747560)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREAREVMKTYIAPYADEVTTDGLGSLIAKKEGKAGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVDIKDMFIDIGAKSRDEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAIAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGV
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPYHFDAMPGGGT
DAGAIHLTGSGVPSLTIAIPTRYIHSHASILHRDDYENTVKLLVEVIKRLDADKVNQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattggacgaaacgttaacaatgctgaaagcgttgacggatgcaaaaggtgtc
ccgggcaatgaacgggaagcgcgcgaagtgatgaaaacatacatagccccatatgcggac
gaagtaacgaccgacggtctcggcagcttgatcgccaaaaaagaaggaaaagctggcgga
ccgaaagtcatgattgccggccatttggacgaagtcggctttatggtcacgcaaatcgat
gataaaggattcatccgcttccaaacgctcggcggctggtggagccaagtgatgctcgcc
caacgagtgaccatcgtaacgaaaaagggcgacatcaccggtgtgatcggttcgaagccg
ccgcacattttgccgccggaggcgcgcaaaaaaccggttgatattaaagatatgttcatt
gacatcggtgcgaagagccgtgacgaagcgatggagtggggcgtccgcccaggcgatatg
atcgtaccgtattttgagtttaccgtgttgaacaatgaaaaaatgctgttagccaaagcg
tgggacaaccggatcggctgtgcgatcgccattgatgtgctcaagcagctgaaaggcgtt
gaccacccgaacacggtgtatggtgtcggcacggtacaggaagaagtcggtttgcgcggg
gcgcgcacggctgcccaattcattcaaccggacatcgcttttgccgttgacgtcggcgtg
gcaggcgatacgccaggtgtctcggaaaaagaagcgatgggcaagctcggcgccggcccg
cacattgtcctatacgatgcaacgatggtgtcgcatcgcggtttgcgcgaatttgtcatc
gaagtggcggaagagctgaacattccgtatcactttgacgccatgccaggcggcggcacg
gacgcgggggcgattcatttaaccggcagcggtgtcccgtcactgacgattgccattcca
acccgctacatccattcgcatgcttccattttgcatcgcgatgactatgaaaacacggtc
aagctattagttgaagtcattaaacggcttgatgctgataaagtgaaccaaattacattt
gaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system