KEGG   Geobacillus thermodenitrificans: GTNG_2664Help
Entry
GTNG_2664         CDS       T00496                                 

Definition
(GenBank) 6-phospho-1-fructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00030  Pentose phosphate pathway
gtn00051  Fructose and mannose metabolism
gtn00052  Galactose metabolism
gtn00680  Methane metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
gtn01230  Biosynthesis of amino acids
gtn03018  RNA degradation
Module
gtn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gtn_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_2664
   00030 Pentose phosphate pathway
    GTNG_2664
   00051 Fructose and mannose metabolism
    GTNG_2664
   00052 Galactose metabolism
    GTNG_2664
  Energy metabolism
   00680 Methane metabolism
    GTNG_2664
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GTNG_2664
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GTNG_2664
Protein phosphatases and associated proteins [BR:gtn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GTNG_2664
Messenger RNA biogenesis [BR:gtn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GTNG_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABO68009
UniProt: A4IRQ5
Position
complement(2773606..2774580)
Genome map
AA seq 324 aa AA seqDB search
MRWKIMKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYYGYAGLIAGNIKKLEVG
DVGDIIHRGGTMLYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEH
GFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGD
IALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQ
EATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQQNQLVDHD
IAEALAQKHTVDQRMYLLSKELSI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggaaaatcatgaaacggattggtgtattgacaagcggcggtgactcgccgggg
atgaacgccgccattcgtgccgtcgtccgcaaggcgatttatcacggcgtggaagtgtat
ggcgtctactacggctatgcggggctgattgccggcaacattaaaaagttggaagtcggc
gatgtcggtgatattatccatcgcggcggcaccatgttatatacggctcgctgtccggag
tttaaaacagaagaagggcagaaaaaagggattgaacagttgaaaaagcatggcattgaa
gggcttgtcgtcatcggtggcgacggttcgtaccaaggggcaaaaaagctgactgaacat
ggttttccgtgcgttggggtaccaggaacgattgataacgacattccaggtacggatttt
acgatcggttttgatacggcgctgaatacagtcattgatgccattgacaaaattcgtgat
acggcaacctcacatgaacggacgtacgtcatcgaagtcatgggtcgtcatgccggcgac
atcgccttatggtccggtcttgctggcggggcggaaacgattttaattccagaagcggac
tacgatatgaacgacgtcattgcccggttgaaacgcggccatgagcgtggcaagaaacat
agcattatcatcgttgctgaaggggttggcagcggtgttgacttcggccggcaaattcaa
gaggcgaccggatttgaaacgcgcgtcactgttttaggccatgtgcagcgcggcgggtcg
ccgacagcgtttgaccgtgtgctagctagccgtcttggcgcccgtgcggtagagttgctg
ttggaaggaaaaggaggacgctgcgtcggcattcaacaaaaccagcttgtcgaccatgac
attgccgaagcgttagcgcagaaacataccgtcgatcagcggatgtacttactgtcgaaa
gaattgtccatctaa

DBGET integrated database retrieval system