KEGG   Geobacillus thermodenitrificans: GTNG_2664Help
Entry
GTNG_2664         CDS       T00496                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTNG_2664
   01230 Biosynthesis of amino acids
    GTNG_2664
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_2664
   00030 Pentose phosphate pathway
    GTNG_2664
   00051 Fructose and mannose metabolism
    GTNG_2664
   00052 Galactose metabolism
    GTNG_2664
  Energy metabolism
   00680 Methane metabolism
    GTNG_2664
Enzymes [BR:gtn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GTNG_2664
Protein phosphatases and associated proteins [BR:gtn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GTNG_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2773606..2774580)
Genome map
AA seq 324 aa AA seqDB search
MRWKIMKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYYGYAGLIAGNIKKLEVG
DVGDIIHRGGTMLYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEH
GFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGD
IALWSGLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQ
EATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQQNQLVDHD
IAEALAQKHTVDQRMYLLSKELSI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggaaaatcatgaaacggattggtgtattgacaagcggcggtgactcgccgggg
atgaacgccgccattcgtgccgtcgtccgcaaggcgatttatcacggcgtggaagtgtat
ggcgtctactacggctatgcggggctgattgccggcaacattaaaaagttggaagtcggc
gatgtcggtgatattatccatcgcggcggcaccatgttatatacggctcgctgtccggag
tttaaaacagaagaagggcagaaaaaagggattgaacagttgaaaaagcatggcattgaa
gggcttgtcgtcatcggtggcgacggttcgtaccaaggggcaaaaaagctgactgaacat
ggttttccgtgcgttggggtaccaggaacgattgataacgacattccaggtacggatttt
acgatcggttttgatacggcgctgaatacagtcattgatgccattgacaaaattcgtgat
acggcaacctcacatgaacggacgtacgtcatcgaagtcatgggtcgtcatgccggcgac
atcgccttatggtccggtcttgctggcggggcggaaacgattttaattccagaagcggac
tacgatatgaacgacgtcattgcccggttgaaacgcggccatgagcgtggcaagaaacat
agcattatcatcgttgctgaaggggttggcagcggtgttgacttcggccggcaaattcaa
gaggcgaccggatttgaaacgcgcgtcactgttttaggccatgtgcagcgcggcgggtcg
ccgacagcgtttgaccgtgtgctagctagccgtcttggcgcccgtgcggtagagttgctg
ttggaaggaaaaggaggacgctgcgtcggcattcaacaaaaccagcttgtcgaccatgac
attgccgaagcgttagcgcagaaacataccgtcgatcagcggatgtacttactgtcgaaa
gaattgtccatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system