KEGG   Geobacillus thermodenitrificans: GTNG_2711Help
Entry
GTNG_2711         CDS       T00496                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTNG_2711
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_2711
   00620 Pyruvate metabolism
    GTNG_2711
   00640 Propanoate metabolism
    GTNG_2711
  Energy metabolism
   00680 Methane metabolism
    GTNG_2711
Enzymes [BR:gtn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GTNG_2711
Lipid biosynthesis proteins [BR:gtn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GTNG_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2826867..2828306)
Genome map
AA seq 479 aa AA seqDB search
MADIEKGDRVFVFMPRLPELYFTVLGIIKTGAIVGPLFEAFMEGAVRDRLEDSGAKAIVT
TPELLPRVPVGDLPELKYVFLVGDDIVEEGPYIDLKKRMNEASKHFDIQWVDRQDGLILH
YTSGSTGKPKGVLHVHNAMIQHYQTAKWVLDLKEDDIYWCTADPGWVTGTSYGIFGPWLC
GASSVIVGGRFSPDAWYQTIQDFGVTVWYSAPTAFRMLMGAGDEVVKKYDLSSLRHVLSV
GEPLNPEVIRWGLKVFGRRIHDTWWMTETGGHLICNYPCMEIKPGSMGKPIPGVQAAIID
DQGNVLPPYRMGNLAIKKGWPSMMKTIWNNPQKYESYFIGDWYVSGDSAYMDEDGYFWFQ
GRVDDVINTSGERVGPFEVESKLVEHPAVAEAGVIGKPDPVRGEIIKAFIALREGYAPSE
ELKEDIRQFVKKGLAAHAAPREIEFRDKLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacattgaaaaaggcgaccgcgtgtttgtgtttatgccgcgtttgccggaactg
tattttacggtgcttggcatcattaaaaccggcgccatcgtcggaccgctgtttgaagcg
tttatggaaggagcggtacgcgaccgtctagaagatagcggagcgaaagcgatcgtcacg
acgccggagctgttgccgcgtgtgccggtcggcgaccttccggaactgaagtacgtcttt
ttagttggtgacgatattgttgaagaagggccgtacatcgatttgaaaaagcggatgaat
gaggcgagcaaacactttgacatccaatgggtggatcgtcaagacggcctgattttgcac
tatacgtccggctcgaccggcaagccgaaaggcgttttgcacgtccataatgcgatgatc
caacactatcaaacagcgaaatgggtgcttgatttaaaagaagatgacatttattggtgc
acagccgatccgggttgggtgaccgggacgtcatacggcattttcggtccgtggctgtgc
ggagcatcgagtgtgatcgtcggaggccgcttcagcccggacgcttggtatcaaacgatt
caagacttcggtgtcaccgtctggtacagcgcaccgacggcgttccgcatgctgatgggc
gcgggcgatgaagtggtgaaaaaatacgacttaagctcgctccgccatgtgttaagcgtc
ggtgagccgctcaacccggaagtcatccgctggggactgaaagtgttcggccgccgcatt
catgatacgtggtggatgacggaaacaggtggtcatctcatttgcaactacccgtgcatg
gaaattaagcctggttcgatggggaaacccattccaggcgtgcaggcagcaatcatcgat
gatcaagggaacgtcctgccgccgtatcggatgggcaacttagccatcaaaaaaggttgg
ccgtcgatgatgaaaacgatttggaacaacccgcaaaaatacgaatcgtactttatcggc
gattggtatgtgtccggcgactcggcttacatggacgaagacggctatttctggttccaa
gggcgcgtggacgatgtgatcaatacatcgggcgagcgcgtcggcccgtttgaagtcgaa
agcaagctcgtcgagcacccggctgttgctgaagccggcgtcatcggcaagccggacccg
gtgcgcggagaaatcatcaaggcgttcatcgcgctccgtgaaggatacgcgccgtcagaa
gagctgaaagaagacattcgccagtttgtgaaaaaagggcttgctgcccatgccgcgccg
cgcgagatcgagttccgcgacaaactgccgaaaacgcgaagcggaaaaattatgcgccgc
gtcttaaaagcgtgggagctcaacttgccgaccggcgacttatcgaccatggaagactaa

DBGET integrated database retrieval system