KEGG   Geobacillus thermodenitrificans: GTNG_2735Help
Entry
GTNG_2735         CDS       T00496                                 

Definition
(GenBank) Xaa-His dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00300  Lysine biosynthesis
gtn01100  Metabolic pathways
gtn01120  Microbial metabolism in diverse environments
gtn01230  Biosynthesis of amino acids
Module
gtn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GTNG_2735
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GTNG_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABO68080
UniProt: A4IRX6
Position
complement(2852485..2853897)
Genome map
AA seq 470 aa AA seqDB search
MTLNINWIEEARKRKDDLVRDVQALVRIPSVRDDSEAQPGAPFGLKVAEALDYMLTRGQA
EGFRVKNVDGFAGHVEMGQGEKLIGVLGHIDVVPPGDGWTVDPFSAHVRDGRIYGRGAID
DKGPTIAAFYAMKIVKELGLPLSKRVRLIIGGDEESDWRCVDHYFKHEEMPDIGFVPDAD
FPIIYAEKGIIDADLQYRLTGSEETGEMTLRSFQAGRRYNMVPDAAEAVVEGAGLEEWSS
RYERFCRDHGLNGNIHHSGEAAVLTLEGVAAHGAEPERGKNAGVYLAQFLASLPLDGGSR
PFVQFVASSFFGDTRGRKLGLAYRDERSGELTVNVGVLSYDRAQGGTIGLNIRYPVTADG
ETIRQTLSNVAVERGLTLGRFHDTKPHYVDPDHEWIRTLQRIYEEQTGEPGRLLAIGGGT
YARSLTAGVAFGALFPGRPDVAHQKDEYVEIDDLVKATAIYAQAIYELAK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgaacatcaactggattgaggaggcacggaaacggaaagacgatttagttcgc
gatgtgcaagcgcttgtccgcattccgagcgttcgtgatgacagcgaggcgcagccagga
gcgccgtttggactgaaagtggcagaagcgctcgattatatgttaacccgcggtcaagcg
gaagggtttcgcgtcaaaaacgtcgacgggtttgccggacatgtggaaatggggcaaggg
gagaagcttatcggtgtgctcggccatatcgacgtcgtgccgcccggggatggctggacg
gttgatccgttctccgctcatgtgagggacggccgcatttacgggcgtggggccatcgat
gacaaagggccgaccatcgctgcgttttacgcaatgaaaatcgtgaaagaactcggcctg
ccgctgagcaagcgggttcgtctcatcatcggaggggatgaggaaagcgattggcggtgt
gtcgaccattatttcaagcatgaagagatgccggacattgggtttgtcccggacgctgat
tttccgattatttatgcggaaaaagggattattgacgctgatttgcaatatcggctgacg
gggagcgaagaaacgggagaaatgacgcttcgctcgtttcaagcaggccgccgctacaat
atggtgcctgatgcggccgaagccgttgtcgaaggagccgggctggaggaatggtctagc
cggtatgagcgcttttgccgtgaccacggattaaacgggaacatccaccatagcggcgaa
gcggctgtgcttacgctggaaggagtggctgctcatggcgccgaaccggagcgcggcaaa
aatgccggcgtctacttggcgcaatttttagcgagccttccgctagatggcggtagccgg
ccgtttgtccagtttgtggcgtcctcgtttttcggcgacacgcgcggacggaagctcggt
ctggcgtatcgggatgagcggagcggtgagctgaccgtgaatgtcggcgtgttgtcatac
gaccgtgcgcagggcgggaccatcgggttgaacattcgctatccggtgacggccgacggg
gaaacgatccgtcaaacgttgtccaacgtggctgttgaacgcggcctgacgctcgggcgt
ttccatgatacgaaaccgcattacgtcgatccggatcatgagtggatccgcacgcttcaa
cgcatctatgaagaacaaaccggtgagcctggtcggctgttggcgattggcggcggcacg
tatgcccgctcgttgaccgccggggtggcgttcggtgctttgtttcctggccgccctgat
gtcgcccatcaaaaagatgaatatgtcgagattgacgatttagtgaaagcgactgccatt
tacgctcaggcgatctatgagctggccaaataa

DBGET integrated database retrieval system