KEGG   Geobacillus thermodenitrificans: GTNG_2782Help
Entry
GTNG_2782         CDS       T00496                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GTNG_2782
Enzymes [BR:gtn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GTNG_2782
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTNG_2782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2898367..2900367)
Genome map
AA seq 666 aa AA seqDB search
MCGHHLALERMRYGLIAANPTDLEVYLFHEGSLYKSYELFGAHVINEGGKVGTRFCVWAP
HAREVRLVGSFNDWDGTDFRLEKVNDEGVWTIVVPENLEGHLYKYEIVTPDGQVLFKADP
YAFYSELRPHTASIAYDLKGYQWNDQSWKRKKRRKRIYDQPMVIYELHFGSWKKKDGRFY
TYREMADELIPYVLDHGFTHIELLPLVEHPLDRSWGYQGTGYYAVTSRYGTPHDFMYFVD
RCHQAGIGVIMDWVPGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDLGKPEVR
SFLISNALFWLEYYHIDGFRVDAVANMLYWPNNDRLYENPYAVEFLRKLNEAVFAYDPNV
LMIAEDSTDWPKVTAPTYEGGLGFNYKWNMGWMNDMLKYMETPPYERRHVHNQVTFSLLY
AYSENFILPFSHDEVVHGKKSLLNKMPGSYEEKFAQLRLLYGYMMAHPGKKLLFMGNEFA
QFDEWKFEDELDWVLFDFELHRKMNDYMKELIACYKRYKPFYELDHDPQGFEWIDVHNAE
QSIFSFIRRGKKEDDVLVIVCNFTNQAYDDYKVGVPLLVPYREVLNSDAVTFGGSGHVNG
KRLSAFNEPFHGKPYHVRMTIPPFGISILRPVQKRGERKRNEKEMHRHVIGRRARKSASL
ADDKHR
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggccatcatcttgctttggaaaggatgcgatacggtttgattgcggcgaatccg
acggatttggaagtgtatttgtttcatgaaggcagcttgtataaaagttacgagctgttt
ggcgcccatgtgattaatgagggcgggaaggtcggcacccgtttttgtgtttgggcgccg
cacgcgcgcgaggtgcgtcttgtcggcagtttcaacgattgggacgggacggattttcgc
cttgagaaagtgaatgatgaaggggtatggacgattgttgtccccgaaaacttggaaggg
catttatataagtatgagattgttacgccggacggacaggtgctgttcaaagccgacccg
tacgctttttactccgaattgcgtcctcataccgcctcgattgcctacgatctgaaagga
taccagtggaacgatcaatcttggaagcggaagaagcgacgaaaacggatttatgatcag
cccatggtgatttatgaactccatttcggttcgtggaagaaaaaagatgggcgtttttat
acgtaccgtgagatggccgatgaactgatcccgtatgtgctcgatcatgggtttacgcac
attgagttgcttcctcttgtcgagcatccgctcgaccgctcgtggggctatcaaggaaca
gggtattatgcggtaacgagtcgctatggtacgccacacgacttcatgtacttcgtcgac
cgttgccatcaggcgggaatcggggtcattatggactgggtgccggggcatttttgcaag
gacgcccatgggttatatatgtttgatggcgccccgacgtatgaatacgcgaatgaaaaa
gaccgagaaaattacgtttgggggacggccaattttgatttaggcaagccggaagtgcgc
agttttctcatctcgaacgcattgttttggctcgagtattaccatatcgacgggttccgg
gtcgatgcggttgccaatatgctttattggccgaacaatgacaggctgtacgagaacccg
tatgcggtcgagtttttgcgcaagttaaacgaagcggtgtttgcctatgatccgaatgtg
ctgatgattgcggaagattcgactgactggccgaaggtgaccgcgccgacgtatgaaggc
ggactcggctttaattataaatggaacatgggctggatgaacgacatgctgaagtacatg
gaaacaccgccgtatgagcggaggcatgtgcataaccaagtaacgttctccctcctttat
gcgtattcggaaaatttcattttgccgttttcccacgatgaagtcgtgcatggcaaaaaa
tcgctgctcaataaaatgccagggtcgtatgaagagaagttcgcccagctgcgcctcttg
tacggctacatgatggctcatccggggaaaaagctgttgtttatgggcaatgaatttgct
cagtttgatgaatggaagtttgaggatgaactcgattgggtgctgtttgattttgagctg
caccggaagatgaacgattacatgaaagagttaatcgcctgctataaacggtataagccg
ttttacgaattggatcatgacccgcaaggatttgaatggattgacgttcacaacgctgaa
caaagcattttctcattcatccgccgcgggaaaaaagaagatgatgtgcttgttattgtt
tgcaatttcacaaatcaggcgtatgacgactacaaagttggagtgccgttgctcgtaccg
tatcgggaagtgctgaatagcgatgcggtcacgtttggtggatcggggcatgtcaatggg
aaacggctttccgccttcaatgagccgtttcatggtaaaccataccacgtgcgcatgacg
attccgccatttggcatttccattttacggccagtgcaaaaacgaggggagagaaagcga
aatgaaaaagaaatgcatcgccatgttattggccggcgggcaaggaagtcggcttcgctc
gctgacgacaaacatcgctaa

DBGET integrated database retrieval system