KEGG   Geobacillus thermodenitrificans: GTNG_2996Help
Entry
GTNG_2996         CDS       T00496                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gtn00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gtn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3092130..3092693
Genome map
AA seq 187 aa AA seqDB search
MTTIYDYLVKKPNGEILSMETYRNKTMLIVNTANHCRFTYQFEDLQRLYKKFAHQGFVIL
GFPSNQFAEQNPENGQETATMCKVKFGVTFPIFEVIDVNGEHAHPLFQYLKEQADCREFG
VNLEEKMLKTKIQEINPFFLDGKNIRWNFTKFLVDANGQVLKRFEPTDSIIDLEHAIEEA
LKAAANA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatttatgattatctagtaaaaaagcctaatggtgaaatcttatccatggaa
acataccgaaataaaacgatgttaattgtgaacacagcaaaccactgtcgttttacatat
caatttgaagatttacaaagattgtataaaaagtttgcccatcaaggattcgtgatttta
ggtttcccaagcaatcagtttgcagagcaaaatcctgaaaacggccaagagacggcaacg
atgtgtaaagtcaaattcggtgtaacgttccctatttttgaagtgattgatgtcaacgga
gaacacgcccatccacttttccaatacttaaaagaacaagcagattgtcgcgagttcggt
gttaatttggaagagaaaatgctgaaaacgaaaattcaagaaatcaacccattcttcctt
gacggcaagaacattcgttggaactttaccaaatttttagtggatgccaacggacaagtc
ctgaaacgatttgaacctacagattccatcatcgatctcgaacatgcgattgaagaggct
ttaaaagcagctgcgaatgcctaa

DBGET integrated database retrieval system