KEGG   Geobacillus thermodenitrificans: GTNG_2996Help
Entry
GTNG_2996         CDS       T00496                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GTNG_2996
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GTNG_2996
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GTNG_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3092130..3092693
Genome map
AA seq 187 aa AA seqDB search
MTTIYDYLVKKPNGEILSMETYRNKTMLIVNTANHCRFTYQFEDLQRLYKKFAHQGFVIL
GFPSNQFAEQNPENGQETATMCKVKFGVTFPIFEVIDVNGEHAHPLFQYLKEQADCREFG
VNLEEKMLKTKIQEINPFFLDGKNIRWNFTKFLVDANGQVLKRFEPTDSIIDLEHAIEEA
LKAAANA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatttatgattatctagtaaaaaagcctaatggtgaaatcttatccatggaa
acataccgaaataaaacgatgttaattgtgaacacagcaaaccactgtcgttttacatat
caatttgaagatttacaaagattgtataaaaagtttgcccatcaaggattcgtgatttta
ggtttcccaagcaatcagtttgcagagcaaaatcctgaaaacggccaagagacggcaacg
atgtgtaaagtcaaattcggtgtaacgttccctatttttgaagtgattgatgtcaacgga
gaacacgcccatccacttttccaatacttaaaagaacaagcagattgtcgcgagttcggt
gttaatttggaagagaaaatgctgaaaacgaaaattcaagaaatcaacccattcttcctt
gacggcaagaacattcgttggaactttaccaaatttttagtggatgccaacggacaagtc
ctgaaacgatttgaacctacagattccatcatcgatctcgaacatgcgattgaagaggct
ttaaaagcagctgcgaatgcctaa

DBGET integrated database retrieval system