KEGG   Geobacillus thermodenitrificans: GTNG_2999Help
Entry
GTNG_2999         CDS       T00496                                 

Definition
thermostable carboxylesterase Est30
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Brite
Enzymes [BR:gtn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GTNG_2999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3096140..3096883)
Genome map
AA seq 247 aa AA seqDB search
MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEE
LVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMY
IKSEETMYEGVLEYAREYKKREGKSAEQIEQEMERFKQTPMKTLKALQALIADVREQLDL
IYAPTFVVQARHDHMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKEQLHEDIYA
FLESLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattgttccgccaaaaccgtttttctttgaagccggtgagcgtgccgttttg
cttttgcatggatttaccggaaactccgctgatgttcggatgctcggacgctttctcgaa
tcaaaaggctacacgtgccatgcgccgatttacaaagggcatggcgtgccgccggaagag
ctcgtccataccggtccggacgattggtggcaagatgtgatgaacggttatcagtttttg
aaaaacaaaggatatgaaaaaatcgcggttgctgggttgtcgcttggaggcgtattttcc
ttaaaattaggttacactgtacctatagaaggaattgtgaccatgtgcgcaccgatgtac
atcaaaagcgaagaaacgatgtatgaaggtgtgcttgagtatgcgcgcgaatataaaaaa
cgggaaggaaaatcggcagaacaaatcgaacaggaaatggaacggttcaaacaaacgccg
atgaaaacattaaaagcgctgcaagcgttgatcgccgatgtgcgtgagcaactggatttg
atttacgcgccgacgtttgtcgttcaagcgcgccatgaccacatgatcaacccggacagc
gccaacatcatttataacgaaattgaatcgccggtcaagcaaatcaaatggtacgaacaa
tccggccatgttattacgcttgatcaagaaaaagagcagctgcatgaagatatttatgcg
tttcttgagtcgttagattggtaa

DBGET integrated database retrieval system